PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV51626.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family TCP
Protein Properties Length: 342aa    MW: 38409.4 Da    PI: 7.909
Description TCP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV51626.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCP97.13.2e-3053121270
         TCP   2 agkkdrhskihTkvggRdRRvRlsaecaarfFdLqdeLGfdkdsktieWLlqqakpaikeltgtssssa 70 
                  g+kdrhsk++T +g+RdRRvRls+++a++++dLqd+LG+ ++sk ++WLl+ ak++i+el+ + +++ 
  KZV51626.1  53 FGGKDRHSKVCTVRGLRDRRVRLSVPTAIQLYDLQDRLGLNQPSKVVDWLLNVAKHEIDELPPLRFPDG 121
                 689***********************************************************9955554 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5136931.54655113IPR017887Transcription factor TCP subgroup
PfamPF036341.1E-2755127IPR005333Transcription factor, TCP
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009965Biological Processleaf morphogenesis
GO:0030154Biological Processcell differentiation
GO:0045962Biological Processpositive regulation of development, heterochronic
Sequence ? help Back to Top
Protein Sequence    Length: 342 aa     Download sequence    Send to blast
MRSDVREEEE DSNRIHEISS TSTTTSMASM NSTSSSSWSR FKDPRIVRVS RAFGGKDRHS  60
KVCTVRGLRD RRVRLSVPTA IQLYDLQDRL GLNQPSKVVD WLLNVAKHEI DELPPLRFPD  120
GRFGQNLHLN SAFLEFGGSQ SNKEGLKAIG NTEITWDDPR KYSKSDVFWG KTKDVPAGKG  180
DRRDGDWPRN QEERQFNFEN QGLFPANNIL SRPNPSSPPN FLDSNAYNNQ VFRWDPSNLT  240
LSQPLDPARD DLHNISLMSM AGSHQILVYQ SGTSSHESHF PSSNSEFDPK QLIFHASQLS  300
VTPTTSTVDE SHTAQPVRPS HFSVTANLLP STANSSKNSS LR
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5zkt_A1e-1760114155Putative transcription factor PCF6
5zkt_B1e-1760114155Putative transcription factor PCF6
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00065PBMTransfer from AT5G60970Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV51626.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011099021.16e-96transcription factor TCP5-like
RefseqXP_011099023.16e-96transcription factor TCP5-like
TrEMBLA0A2Z7D3920.0A0A2Z7D392_9LAMI; Plastid transcription factor 1 isoform 1
STRINGEOY036991e-73(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA8212499
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G60970.13e-44TEOSINTE BRANCHED 1, cycloidea and PCF transcription factor 5