PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV49778.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Dof
Protein Properties Length: 334aa    MW: 36679.9 Da    PI: 8.7088
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV49778.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof126.67.6e-403491461
      zf-Dof  4 kalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrknkks 61
                +alkcprCdstntkfCyynny+l+qPr+fCk+CrryWtkGGalrnvP+Ggg+rknkk+
  KZV49778.1 34 AALKCPRCDSTNTKFCYYNNYNLTQPRHFCKTCRRYWTKGGALRNVPIGGGCRKNKKM 91
                679*****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
ProDomPD0074785.0E-273490IPR003851Zinc finger, Dof-type
PfamPF027011.7E-333590IPR003851Zinc finger, Dof-type
PROSITE profilePS5088429.7493690IPR003851Zinc finger, Dof-type
PROSITE patternPS0136103874IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 334 aa     Download sequence    Send to blast
MSHADKNILA GKDESKGSTS RRSAATKPQE ASSAALKCPR CDSTNTKFCY YNNYNLTQPR  60
HFCKTCRRYW TKGGALRNVP IGGGCRKNKK MKPFQRVPGD PKEENGSSDM GGFRIFQGIS  120
PAMDFQLGGL NFPRLQPSTT TNLFNQFPSC GNLANICGTT SSGPHLILDP SPTSSPHLGL  180
ITSTQGFQEM AGSLNLRSNL ASSIESLSSI NQDLHLKLQQ QRLSMMYVGN NQKENSANIP  240
SESDHIIEPL VQKPQPILFQ NLDIYKQDYS NAIGISRKEG ADEHLSTEWF FDNSYATVTP  300
SAPATSRSYA NESTGNWSGS QAWSSDLSQY NSLP
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV49778.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022842998.11e-123dof zinc finger protein DOF5.7-like
TrEMBLA0A2Z7CSS40.0A0A2Z7CSS4_9LAMI; Dof-type zinc finger DNA-binding family protein
STRINGEOX918921e-116(Theobroma cacao)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA52422234
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G65590.12e-45Dof family protein