PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV45888.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Dof
Protein Properties Length: 285aa    MW: 32158.9 Da    PI: 6.9733
Description Dof family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV45888.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-Dof111.44.1e-354398358
      zf-Dof  3 ekalkcprCdstntkfCyynnyslsqPryfCkaCrryWtkGGalrnvPvGggrrkn 58
                ++ lkcprC stntkfCy+nny+ sqPr+fCk+C+r+WtkGG+lrnvPvGggr+++
  KZV45888.1 43 SEPLKCPRCSSTNTKFCYFNNYNKSQPRHFCKSCKRHWTKGGTLRNVPVGGGRKNK 98
                5789***********************************************97654 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF027016.4E-314597IPR003851Zinc finger, Dof-type
ProDomPD0074783.0E-214698IPR003851Zinc finger, Dof-type
PROSITE profilePS5088427.12146100IPR003851Zinc finger, Dof-type
PROSITE patternPS0136104884IPR003851Zinc finger, Dof-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 285 aa     Download sequence    Send to blast
MGLSTQQVLH DRQDEDWDKT NFLQSGTAEP PKPPPIRQQQ PRSEPLKCPR CSSTNTKFCY  60
FNNYNKSQPR HFCKSCKRHW TKGGTLRNVP VGGGRKNKGP KISTTSTTIT AASRMQACRK  120
FPVVTNIIDQ ETTFNTLYHS LILPLPLSCS STNGIITKLV MGRNGTDNTT DLNVSEPQNL  180
NPEFTFSSLD TFEMNSSSIM TPSYESITEY GQYYLNCFES IEESTITTEN IPSTSSIPWP  240
SPDTRTTGIE DFPNYWNCVW KNEIDLSTSS DINKVLDHDK TETKP
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011096259.17e-90PREDICTED: dof zinc finger protein DOF1.4-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA61712033
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G21270.13e-27DOF zinc finger protein 2