PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV41282.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family WOX
Protein Properties Length: 230aa    MW: 26431.1 Da    PI: 7.7051
Description WOX family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV41282.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1Homeobox66.63.2e-211271357
                --SS--HHHHHHHHHHHHH.SSS--HHHHHHHHHHC....TS-HHHHHHHHHHHHHHHHC CS
    Homeobox  3 kRttftkeqleeLeelFek.nrypsaeereeLAkkl....gLterqVkvWFqNrRakekk 57
                +R+++tkeq+ +Le+++++  r+psae++++++++l    +++ ++V++WFqN++a++++
  KZV41282.1 12 SRWSPTKEQISILENFYRQgLRTPSAEQIQQITARLrafgHIEGKNVFYWFQNHKARQRQ 71
                6*****************99**************************************97 PP

2Wus_type_Homeobox113.69.9e-371273465
  Wus_type_Homeobox  4 tRWtPtpeQikiLeelyksGlrtPnkeeiqritaeLeeyGkiedkNVfyWFQNrkaRerqkq 65
                       +RW+Pt+eQi iLe+ y++GlrtP++e+iq+ita+L+++G+ie+kNVfyWFQN+kaR+rqkq
         KZV41282.1 12 SRWSPTKEQISILENFYRQGLRTPSAEQIQQITARLRAFGHIEGKNVFYWFQNHKARQRQKQ 73
                       7***********************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003894.6E-7976IPR001356Homeobox domain
SuperFamilySSF466891.67E-13980IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.607.6E-91271IPR009057Homeodomain-like
PfamPF000466.6E-191271IPR001356Homeobox domain
CDDcd000863.87E-71373No hitNo description
PROSITE profilePS5007110.9161372IPR001356Homeobox domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008284Biological Processpositive regulation of cell proliferation
GO:0009942Biological Processlongitudinal axis specification
GO:0010654Biological Processapical cell fate commitment
GO:0048825Biological Processcotyledon development
GO:0080167Biological Processresponse to karrikin
GO:0090451Biological Processcotyledon boundary formation
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEGESENLGG GSRWSPTKEQ ISILENFYRQ GLRTPSAEQI QQITARLRAF GHIEGKNVFY  60
WFQNHKARQR QKQKQESFAY FNRFLHSSPL FPQYHNVVCG PCYNIPQPQF EAGFLPQRPK  120
VSGSKSRLTS QPFHHHYPRS RNEDYLYPIS TPKNLRANNQ ETLDLFPIHP TGILQSKNGN  180
GIDNGTASST PSTSSENDQC STVEEENGNR HGYHHDQDLD HPFFDFFCGN
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV41282.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077272.14e-77WUSCHEL-related homeobox 2
TrEMBLA0A2Z7C3591e-171A0A2Z7C359_9LAMI; WUSCHEL-related homeobox 2-like
STRINGGLYMA12G06895.13e-64(Glycine max)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA114141925
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59340.12e-46WUSCHEL related homeobox 2