PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV40951.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family GRF
Protein Properties Length: 510aa    MW: 56575.7 Da    PI: 7.4972
Description GRF family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV40951.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRC73.42.5e-23170213144
         WRC   1 daepgrCrRtDGKkWRCsrrvlegkklCErHlhrgrsrsrkske 44 
                 d+epgrC+RtDGKkWRCs++v + +k+CErHlh+gr rsrk++e
  KZV40951.1 170 DPEPGRCKRTDGKKWRCSKDVAPMQKYCERHLHKGRLRSRKPVE 213
                 79***************************************998 PP

2QLQ39.51.7e-14107140235
         QLQ   2 aFTaaQlqlLksQilAyKyLaanqPvPpeLlqai 35 
                 aFT aQ  +L++Q+++++yL  n+P+P++Ll ++
  KZV40951.1 107 AFTSAQRKELERQAMIFRYLTTNLPLPHDLLYPL 140
                 7*****************************9887 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM009518.3E-5106142IPR014978Glutamine-Leucine-Glutamine, QLQ
PfamPF088803.9E-10107140IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166617.641107142IPR014978Glutamine-Leucine-Glutamine, QLQ
PROSITE profilePS5166724.32170214IPR014977WRC domain
PfamPF088792.3E-19171213IPR014977WRC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005634Cellular Componentnucleus
GO:0005524Molecular FunctionATP binding
Sequence ? help Back to Top
Protein Sequence    Length: 510 aa     Download sequence    Send to blast
MEAHQRARMA VKRLLNSKVN PTDYTLSFET RTIDEQLFNA YSYTLKSQVF DEVLSNIYWD  60
GGSTTCVGST APGFKLNTLQ TFDISPPLNS TTASKASGAM ASSVGLAFTS AQRKELERQA  120
MIFRYLTTNL PLPHDLLYPL SLNFASPALD PSINLSGGEL RNDGCLKIRD PEPGRCKRTD  180
GKKWRCSKDV APMQKYCERH LHKGRLRSRK PVEVRKKMRL EQGPLPAPRA SSSASHQIST  240
QNESRLLFNP IESDRNAGVM MEFESTENNW QHLMKKGNLD FLANGFFSTR GFNPTLHQDC  300
VETSNPFPYS SFQAQSGVIN TWSMDNDNAT SCPVSLHQGN AFPSLYLSMD VASANVLDGE  360
SNKIEIEVGL EDSDDCYVAD TRSLPCYRGG PLGEALQPLS VGVESSNPAS PYDSVHTTAT  420
TVSSPSGVLH RTSFSHSENS VCNSPADVSF LALSSCKSIS AQNRNSSRKT MVAKQPHDIE  480
VLSSFIFLMF SRLDLFYELY QLNLMFKLVR
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1204216RLRSRKPVEVRKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV40951.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2Z7C4X10.0A0A2Z7C4X1_9LAMI; Growth-regulating factor 6-like
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA70322230
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37740.11e-30growth-regulating factor 2