PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV39927.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CO-like
Protein Properties Length: 330aa    MW: 36326.5 Da    PI: 5.9297
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV39927.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box19.81.6e-061141434
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeH 34
                ++C  ++   +  fC+ ++ +lC  C  + H
  KZV39927.1 11 KICGSCKTSSAAVFCNADSAFLCIACDAKVH 41
                79******99*****************9998 PP

2zf-B_box24.55.5e-085398342
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                 + C+ +e+ + +  C+ +   lC++C   +H+       H++vp+
  KZV39927.1 53 VWLCEVCEQAPSSVTCKADAAALCASCDHDIHSAnplarrHERVPV 98
                679*****************************66899999*99986 PP

3CCT69.21e-23267311145
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqae 45 
                 Rea++lRY+eKrk+R+FeK+irY+sRKa+Ae+RpR+KGrF+k++e
  KZV39927.1 267 REARVLRYREKRKNRRFEKTIRYASRKAYAETRPRIKGRFAKRSE 311
                 9*****************************************975 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003361.5E-6855IPR000315B-box-type zinc finger
PROSITE profilePS501199.84855IPR000315B-box-type zinc finger
PfamPF006436.3E-61150IPR000315B-box-type zinc finger
CDDcd000213.52E-61255No hitNo description
PROSITE profilePS5011910.4245198IPR000315B-box-type zinc finger
PfamPF006436.3E-65398IPR000315B-box-type zinc finger
CDDcd000213.76E-85498No hitNo description
SMARTSM003365.8E-75698IPR000315B-box-type zinc finger
PfamPF062031.4E-17267309IPR010402CCT domain
PROSITE profilePS5101716.797267309IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 330 aa     Download sequence    Send to blast
MAAPKWSLTA KICGSCKTSS AAVFCNADSA FLCIACDAKV HAVNVLASRH ARVWLCEVCE  60
QAPSSVTCKA DAAALCASCD HDIHSANPLA RRHERVPVAP FYGAVDKSSS EEEEAEAESW  120
LIPNLNTDNG GVDLEEDSGS PEYKSAEYLF RDMDPYLDLD LFSGEQKQHQ HQQLLSPDGV  180
VPDHTKNKFG SGQYPSGPVV DGFPAYEMDY PGPKHIMYNF TSQSISHSVS SSSLDAGVVP  240
EHHVTAEVSN GFENSEIAPT PLSGVDREAR VLRYREKRKN RRFEKTIRYA SRKAYAETRP  300
RIKGRFAKRS ELEIESFVAL EASYGVVPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV39927.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078988.11e-156zinc finger protein CONSTANS-LIKE 4-like
SwissprotQ940T92e-88COL4_ARATH; Zinc finger protein CONSTANS-LIKE 4
TrEMBLA0A2Z7C5U30.0A0A2Z7C5U3_9LAMI; Zinc finger protein CONSTANS-LIKE 4-like
STRINGXP_009590370.11e-140(Nicotiana tomentosiformis)
STRINGXP_009618115.11e-140(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G24930.14e-85CONSTANS-like 4