PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV37791.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CPP
Protein Properties Length: 702aa    MW: 78012 Da    PI: 5.751
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV37791.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.43.2e-14363401442
         TCR   4 kgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                  +C+Ckk kC+k+YC+Cfaa+++C+e+C+C++C N ee+
  KZV37791.1 363 SSCQCKKIKCMKLYCDCFAAKVYCAETCSCQGCLNVEEH 401
                 57*********************************9986 PP

2TCR48.61.6e-15451488239
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 + +gC+Ckks ClkkYC+C+++++ Cs+ C+Ce+C+N+
  KZV37791.1 451 HIRGCSCKKSMCLKKYCDCYQSKVGCSDGCRCEGCQNE 488
                 789**********************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011148.0E-11360401IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163431.646361490IPR005172CRC domain
PfamPF036381.3E-10364398IPR005172CRC domain
SMARTSM011144.3E-16450491IPR033467Tesmin/TSO1-like CXC domain
PfamPF036383.9E-11453488IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 702 aa     Download sequence    Send to blast
MSAEDQGCNN GLPSVNGSGN DQIQHPSANP GKVLADNVNM DFVDPNNSLN PARKQPEHVD  60
QPPKGDVAWE ENVIKHGHDY CTEVQVEKAA FAPHAFINQD LGDFMPEAFQ QRDIRWNYLQ  120
FEDAQNKLET NWHSQIDLDE QLARSLSLMR QQTPANFLQS IPYPKLYLHP TPMISIAKPS  180
SSGLQQLRTN GHSQISSDDE GAGLLSLARK QTPFNTYQPV SYPKPYLDPT SFMSINRPSS  240
SGLGPNNVFN SGATMNMKSA QMGSLNMQEW MPKPLFKPVA ESLLREITHN RNLKSLLYAR  300
LMQSLNRYGV SNPVKDQSTQ ADKSEHKAEN VGDEEEFDRS NPRIGSQAQK RKSQRSRGDA  360
FVSSCQCKKI KCMKLYCDCF AAKVYCAETC SCQGCLNVEE HNDEVLEARE LIESRNPLAF  420
APKVIQNSIK PSATGGYRED GALLSPSSAR HIRGCSCKKS MCLKKYCDCY QSKVGCSDGC  480
RCEGCQNEYG RKGGITKAPS SGEGSEQRTD SSILDTPAPT NECLNSHLGT DQNQEEESKN  540
WSSVEKYLPS PDSRLPLDNN DRVIGIGDES LHLHPFLPEQ EPDLGNAKTR DEFQFPIPYD  600
KPEGTGTSCG VPNYMEWTNW IGSQMSPLLD FRGNRHNEVD AFGCELANNL KDDQPETLEV  660
TPTSLKSVNV STQNKKRVCP PPDPVQEFGS LKSVHTSPGQ QM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A9e-1536548714120Protein lin-54 homolog
5fd3_B9e-1536548714120Protein lin-54 homolog
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV37791.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
TrEMBLA0A2Z7BTA60.0A0A2Z7BTA6_9LAMI; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.11e-49Tesmin/TSO1-like CXC domain-containing protein