PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV36185.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CO-like
Protein Properties Length: 364aa    MW: 40328.6 Da    PI: 7.7843
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV36185.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box24.36.3e-082162440
    zf-B_box  4 rkCpeHeekelqlfCedCqqllCedClleeHkg.....Htvv 40
                + C+ +++  + lfC+  + ++C +C ++ H++     H++v
  KZV36185.1 21 KPCDYCKSAAALLFCRVESAFMCMSCDSKVHNNvpplkHERV 62
                68*******9*********************98999999865 PP

2zf-B_box23.21.5e-0762106341
    zf-B_box   3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvp 41 
                  ++C+ +e+ ++   C+ +   lC +C   +H        H+++p
  KZV36185.1  62 VWMCEVCEQAPAAVTCKADAAALCVTCDNDIHCAnplarrHERSP 106
                 689*****************************6567777788877 PP

3CCT713e-24292335144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eK+k+RkFeK+irY+sRKa+Ae+RpR+KGrFvk++
  KZV36185.1 292 REARVLRYREKKKNRKFEKTIRYASRKAYAETRPRIKGRFVKRT 335
                 9*****************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS501199.2571864IPR000315B-box-type zinc finger
SMARTSM003360.081856IPR000315B-box-type zinc finger
PfamPF006435.1E-62161IPR000315B-box-type zinc finger
CDDcd000216.66E-72264No hitNo description
SMARTSM003363.3E-1360107IPR000315B-box-type zinc finger
PROSITE profilePS5011910.5860107IPR000315B-box-type zinc finger
PfamPF006432.0E-562107IPR000315B-box-type zinc finger
CDDcd000216.26E-863107No hitNo description
PROSITE profilePS5101716.648292334IPR010402CCT domain
PfamPF062033.5E-18292334IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 364 aa     Download sequence    Send to blast
MGSGGVARTR CFPPAFHAAA KPCDYCKSAA ALLFCRVESA FMCMSCDSKV HNNVPPLKHE  60
RVWMCEVCEQ APAAVTCKAD AAALCVTCDN DIHCANPLAR RHERSPVLPF YDTAESMLLI  120
KSSTAAAFPA PIGNPGDKLD NFVSQNSYIT DSWVSDNPIA ATKFLDNNRF VKPMEFLFSD  180
SDPFLNYDSF EIPSQPCSDS VVPVQTTTKA PVTAHLADKS PEIQFDIDFR KSSIISYNNS  240
YNNPSLSRSI SSSTMEVGVV PDGSETSYPT ARTMSSVDLS GNQSSQVVDM DREARVLRYR  300
EKKKNRKFEK TIRYASRKAY AETRPRIKGR FVKRTDSEPD INRFFGPGSG DFIMDARYGV  360
VPSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV36185.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.11e-149zinc finger protein CONSTANS-LIKE 5-like
TrEMBLA0A2Z7BVV10.0A0A2Z7BVV1_9LAMI; Zinc finger protein CONSTANS-LIKE 5-like
STRINGMigut.K00262.1.p1e-130(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.19e-86CONSTANS-like 5