PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV35756.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family G2-like
Protein Properties Length: 294aa    MW: 32569.1 Da    PI: 6.7172
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV35756.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like107.28.8e-344296155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +prlrWt eLHerFv+av+qLGG++kAtPkti++ m+vkgLtl+h+kSHLQkYR+
  KZV35756.1 42 RPRLRWTAELHERFVDAVTQLGGPDKATPKTIMRSMGVKGLTLYHLKSHLQKYRM 96
                59****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129412.4653999IPR017930Myb domain
Gene3DG3DSA:1.10.10.602.9E-324097IPR009057Homeodomain-like
SuperFamilySSF466899.32E-174298IPR009057Homeodomain-like
TIGRFAMsTIGR015571.6E-234397IPR006447Myb domain, plants
PfamPF002492.8E-94495IPR001005SANT/Myb domain
PfamPF143794.5E-27140186IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009567Biological Processdouble fertilization forming a zygote and endosperm
GO:0010628Biological Processpositive regulation of gene expression
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 294 aa     Download sequence    Send to blast
MYSGMPLHSL AMEGSGGEYQ RAALDGTNLP GDSCLVLSTD PRPRLRWTAE LHERFVDAVT  60
QLGGPDKATP KTIMRSMGVK GLTLYHLKSH LQKYRMGKQS NKEVTDNSKE ASCIAETQDT  120
GSSTSASTVM MSQEINDGYH VTEALRVQME VQRRLHEQLE VQRRLQLRIE AQGKYLQSIL  180
EKACKALSEQ ALASAGLDAA REELSELAIK VASECNVLTI IPPESDLAFN VHDQNVLNLP  240
ARLGDCSTNR SVVSPMPESA VVLKKRPRDM FRNGELLHFD SSTRPVEWMM SNIG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-194298157Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-194298258Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV35756.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011091432.11e-153protein PHR1-LIKE 2 isoform X2
SwissprotQ8LAJ71e-120PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A2Z7BN720.0A0A2Z7BN72_9LAMI; Uncharacterized protein
STRINGXP_006493809.11e-134(Citrus sinensis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA37912344
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-122G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]