PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV32979.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NAC
Protein Properties Length: 251aa    MW: 28960.3 Da    PI: 5.3521
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV32979.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM163.76.9e-51101381129
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLpkkvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlsk.kge 98 
                 lppGfrF P+deel+++yL kk++++++    ++ e+d++++ePw+Lp ++k +++ewyfFs rd+kyatg r+nrat+sgyWkatgkd+ v++  +++
  KZV32979.1  10 LPPGFRFYPSDEELICHYLYKKIANEEVVR-GTLMEIDLHTCEPWQLPDSAKLNSSEWYFFSFRDRKYATGYRTNRATTSGYWKATGKDRMVVDPgTRA 107
                 79*************************777.78***************88888999**************************************96677 PP

         NAM  99 lvglkktLvfykgrapkgektdWvmheyrle 129
                 +vg++ktLvfyk+rap+g kt W+mhe+rle
  KZV32979.1 108 VVGMRKTLVFYKNRAPNGIKTGWIMHEFRLE 138
                 8***************************985 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019414.45E-618156IPR003441NAC domain
PROSITE profilePS5100558.0910156IPR003441NAC domain
PfamPF023651.0E-2711137IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 251 aa     Download sequence    Send to blast
MGLRDIGATL PPGFRFYPSD EELICHYLYK KIANEEVVRG TLMEIDLHTC EPWQLPDSAK  60
LNSSEWYFFS FRDRKYATGY RTNRATTSGY WKATGKDRMV VDPGTRAVVG MRKTLVFYKN  120
RAPNGIKTGW IMHEFRLENP HVPPKEDWVL CRVFYKTRCE NTTQNVYNDH LNTSCANLDG  180
GFQNVITSFF SQNPSTSGPD YLLDHQLSQY NIDSINDLDR DPSSSTPRCE DDYGFLFDMN  240
FDDDSNGLIM S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A2e-49915616165NO APICAL MERISTEM PROTEIN
1ut4_B2e-49915616165NO APICAL MERISTEM PROTEIN
1ut7_A2e-49915616165NO APICAL MERISTEM PROTEIN
1ut7_B2e-49915616165NO APICAL MERISTEM PROTEIN
3swm_A2e-49915619168NAC domain-containing protein 19
3swm_B2e-49915619168NAC domain-containing protein 19
3swm_C2e-49915619168NAC domain-containing protein 19
3swm_D2e-49915619168NAC domain-containing protein 19
3swp_A2e-49915619168NAC domain-containing protein 19
3swp_B2e-49915619168NAC domain-containing protein 19
3swp_C2e-49915619168NAC domain-containing protein 19
3swp_D2e-49915619168NAC domain-containing protein 19
4dul_A2e-49915616165NAC domain-containing protein 19
4dul_B2e-49915616165NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription activator. Involved in molecular mechanisms regulating shoot apical meristem (SAM) formation during embryogenesis and organ separation. Required for axillary meristem initiation and separation of the meristem from the main stem. May act as an inhibitor of cell division. {ECO:0000269|PubMed:12837947, ECO:0000269|PubMed:17122068}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV32979.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: By BRM, at the chromatin level, and conferring a very specific spatial expression pattern. {ECO:0000269|PubMed:16854978}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_009607926.11e-116PREDICTED: NAC domain-containing protein 21/22-like
RefseqXP_022879040.11e-116protein CUP-SHAPED COTYLEDON 3-like
SwissprotQ9S8511e-61NAC31_ARATH; Protein CUP-SHAPED COTYLEDON 3
TrEMBLA0A2Z7BHR20.0A0A2Z7BHR2_9LAMI; NAC domain-containing protein 21/22-like
STRINGXP_009607926.11e-116(Nicotiana tomentosiformis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA18822466
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28530.13e-90NAC domain containing protein 74
Publications ? help Back to Top
  1. Chen C, et al.
    Transcriptome profiling reveals roles of meristem regulators and polarity genes during fruit trichome development in cucumber (Cucumis sativus L.).
    J. Exp. Bot., 2014. 65(17): p. 4943-58
    [PMID:24962999]
  2. Gonçalves B, et al.
    A conserved role for CUP-SHAPED COTYLEDON genes during ovule development.
    Plant J., 2015. 83(4): p. 732-42
    [PMID:26119568]
  3. Balkunde R,Kitagawa M,Xu XM,Wang J,Jackson D
    SHOOT MERISTEMLESS trafficking controls axillary meristem formation, meristem size and organ boundaries in Arabidopsis.
    Plant J., 2017. 90(3): p. 435-446
    [PMID:28161901]
  4. Espinosa-Ruiz A, et al.
    TOPLESS mediates brassinosteroid control of shoot boundaries and root meristem development in Arabidopsis thaliana.
    Development, 2017. 144(9): p. 1619-1628
    [PMID:28320734]
  5. Koyama T,Sato F,Ohme-Takagi M
    Roles of miR319 and TCP Transcription Factors in Leaf Development.
    Plant Physiol., 2017. 175(2): p. 874-885
    [PMID:28842549]