PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV32904.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family NAC
Protein Properties Length: 321aa    MW: 36815.2 Da    PI: 4.9101
Description NAC family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV32904.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1NAM176.11e-5461331128
         NAM   1 lppGfrFhPtdeelvveyLkkkvegkkleleevikevdiykvePwdLp.k.kvkaeekewyfFskrdkkyatgkrknratksgyWkatgkdkevlskkg 97 
                 lppGfrFhPtdeelv +yL +k++g  +el evi+evd+yk+ePwdLp k  + +++ ewyf+s+rd+ky++g r+nrat+ gyWkatgkd++v+s ++
  KZV32904.1   6 LPPGFRFHPTDEELVAYYLDRKINGGIIEL-EVIPEVDLYKCEPWDLPdKsFLPSKDMEWYFYSPRDRKYPNGLRTNRATRVGYWKATGKDRAVHS-GK 102
                 79***************************9.99**************96435566888**************************************.99 PP

         NAM  98 elvglkktLvfykgrapkgektdWvmheyrl 128
                 ++vg+kktLv+ykgrap+g +tdWvmheyrl
  KZV32904.1 103 RAVGMKKTLVYYKGRAPHGIRTDWVMHEYRL 133
                 9****************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF1019418.76E-623157IPR003441NAC domain
PROSITE profilePS5100559.4416157IPR003441NAC domain
PfamPF023657.1E-297133IPR003441NAC domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0044212Molecular Functiontranscription regulatory region DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 321 aa     Download sequence    Send to blast
MGPMTLPPGF RFHPTDEELV AYYLDRKING GIIELEVIPE VDLYKCEPWD LPDKSFLPSK  60
DMEWYFYSPR DRKYPNGLRT NRATRVGYWK ATGKDRAVHS GKRAVGMKKT LVYYKGRAPH  120
GIRTDWVMHE YRLLQFVSGA DQSPLQDSYA LCRVFKKNTI VSKPNETLDR LSTYDNISSA  180
ETSRDETAYD ETIIEDHETG PKFDPSASDL TQGTSTPVNH DLYSHIMTSQ EVNSSVNQFY  240
FPELENVSNF IFQDAMMNPS NIYSSVVSEK NPCPPLALED FPDIDLASAK SISEYMSCDR  300
FRTTTTLEDM FSTYDNFSYK S
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ut4_A9e-55416315171NO APICAL MERISTEM PROTEIN
1ut4_B9e-55416315171NO APICAL MERISTEM PROTEIN
1ut7_A9e-55416315171NO APICAL MERISTEM PROTEIN
1ut7_B9e-55416315171NO APICAL MERISTEM PROTEIN
3swm_A1e-54416318174NAC domain-containing protein 19
3swm_B1e-54416318174NAC domain-containing protein 19
3swm_C1e-54416318174NAC domain-containing protein 19
3swm_D1e-54416318174NAC domain-containing protein 19
3swp_A1e-54416318174NAC domain-containing protein 19
3swp_B1e-54416318174NAC domain-containing protein 19
3swp_C1e-54416318174NAC domain-containing protein 19
3swp_D1e-54416318174NAC domain-containing protein 19
4dul_A9e-55416315171NAC domain-containing protein 19
4dul_B9e-55416315171NAC domain-containing protein 19
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor directing sieve element enucleation and cytosol degradation. Not required for formation of lytic vacuoles. Regulates, with NAC086, the transcription of NEN1, NEN2, NEN3, NEN4, RTM1, RTM2, UBP16, PLDZETA, ABCB10 and At1g26450. {ECO:0000269|PubMed:25081480}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00205DAPTransfer from AT1G54330Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV32904.1
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Regulated by the transcription factor APL (AC Q9SAK5). {ECO:0000269|PubMed:25081480}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095829.11e-132NAC transcription factor 29
SwissprotA4VCM04e-85NAC45_ARATH; NAC domain-containing protein 45
TrEMBLA0A2Z7BEM00.0A0A2Z7BEM0_9LAMI; NAC domain-containing protein 45
STRINGMigut.M01499.1.p1e-124(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA46212442
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G54330.12e-92NAC domain containing protein 20
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]