PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV29583.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CO-like
Protein Properties Length: 337aa    MW: 37463.9 Da    PI: 6.0983
Description CO-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV29583.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1zf-B_box284.7e-091247338
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkgHt 38
                +r C+ +++  + lfC+ ++ +lC  C ++ H++Ht
  KZV29583.1 12 ARSCDYCKSAAALLFCTVDSAFLCIACDSKVHNSHT 47
                578*******9*********************9987 PP

2zf-B_box25.72.3e-085297342
    zf-B_box  3 erkCpeHeekelqlfCedCqqllCedClleeHkg......Htvvpl 42
                 ++C+ +e+  +   C+ +   lC dC   +H+       H+++p+
  KZV29583.1 52 VWMCEVCEQAAAVVSCKADAAVLCSDCDRDIHSAnplarrHDRTPV 97
                689*******9*********************66888888988875 PP

3CCT68.42e-23266309144
         CCT   1 ReaallRYkeKrktRkFeKkirYesRKavAesRpRvKGrFvkqa 44 
                 Rea++lRY+eKrk+R+F+K+irY+sRKa+Ae+RpR+KGrF+k++
  KZV29583.1 266 REARVLRYREKRKNRRFQKTIRYASRKAYAETRPRIKGRFAKRT 309
                 9*****************************************86 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003360.0411048IPR000315B-box-type zinc finger
PROSITE profilePS5011910.2531054IPR000315B-box-type zinc finger
CDDcd000211.55E-81354No hitNo description
PfamPF006432.1E-71348IPR000315B-box-type zinc finger
SMARTSM003368.0E-125097IPR000315B-box-type zinc finger
PROSITE profilePS5011910.315097IPR000315B-box-type zinc finger
PfamPF006434.6E-65297IPR000315B-box-type zinc finger
CDDcd000219.79E-85397No hitNo description
PfamPF062032.1E-17266308IPR010402CCT domain
PROSITE profilePS5101716.678266308IPR010402CCT domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005622Cellular Componentintracellular
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 337 aa     Download sequence    Send to blast
MHGGGPEFFP AARSCDYCKS AAALLFCTVD SAFLCIACDS KVHNSHTKHE RVWMCEVCEQ  60
AAAVVSCKAD AAVLCSDCDR DIHSANPLAR RHDRTPVVPF YENAESVVLN SAAEPIMPIH  120
NSTTSSVVEQ TDLLTNASSW ISSKLPAQRP DIKSIDYLFS DSDQLLDFEI SPQISSHFLS  180
DCVVPVQTTT LQALPPPRNY SSENRFEIDF TISNVNSYSN SYTTSSLDQP QSSMDLGVVP  240
EGSSLSDTSF PYVNTMVGNP VSALDREARV LRYREKRKNR RFQKTIRYAS RKAYAETRPR  300
IKGRFAKRTS DGADPVFLSG SPEDYVFDAR YDVVMSF
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV29583.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011069877.11e-124zinc finger protein CONSTANS-LIKE 5-like
SwissprotQ9FHH86e-90COL5_ARATH; Zinc finger protein CONSTANS-LIKE 5
TrEMBLA0A2G9HFV01e-121A0A2G9HFV0_9LAMI; GATA-4/5/6 transcription factor
STRINGMigut.K00262.1.p1e-107(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA10352376
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G57660.11e-81CONSTANS-like 5
Publications ? help Back to Top
  1. Vercruyssen L, et al.
    ANGUSTIFOLIA3 binds to SWI/SNF chromatin remodeling complexes to regulate transcription during Arabidopsis leaf development.
    Plant Cell, 2014. 26(1): p. 210-29
    [PMID:24443518]