PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV29457.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Trihelix
Protein Properties Length: 292aa    MW: 33420.2 Da    PI: 4.6466
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV29457.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix32.62.1e-101887271
    trihelix  2 WtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkr 71
                W+ +e l L++    +e++ +++    ++W+++ +++ +  ++r+ +qC+ +w+++  +yk++k+  ++ 
  KZV29457.1 18 WSAEESLILVNEIHAIESEWGTTLPSYQKWKQIVDNCNSLDVNRNLNQCRRRWNEIFSEYKRVKNAPGGY 87
                ****************************************************************987764 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF138376.4E-1017100No hitNo description
Gene3DG3DSA:1.10.10.603.7E-51774IPR009057Homeodomain-like
PROSITE profilePS500907.4911874IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009506Cellular Componentplasmodesma
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 292 aa     Download sequence    Send to blast
MAEPRMSHRT RSKAAPDWSA EESLILVNEI HAIESEWGTT LPSYQKWKQI VDNCNSLDVN  60
RNLNQCRRRW NEIFSEYKRV KNAPGGYGSL QADLFDAIDR CVSAKGKRGG DDEVEDEPAE  120
EIEAAKLEDE EEDQAVMDTD PDSDPEAQGR VTKFFFEAGS KKQKRRMKRQ KRRIEKLNPW  180
GYFTSPKIKL EDSSNTNGKL ENTNCMSLLE ESTVETKEQN MCRILQENAL QINALLECDT  240
AADVDYNLAD LKNAEAVEKT DSTRQRGDKL IIYLENISRT LKDLSDLVEQ CK
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1160168KKQKRRMKR
2163170KRRMKRQK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_012847324.11e-94PREDICTED: uncharacterized protein LOC105967267
RefseqXP_012847325.11e-94PREDICTED: uncharacterized protein LOC105967268
TrEMBLA0A022QKB52e-94A0A022QKB5_ERYGU; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA83602124
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G31270.12e-27sequence-specific DNA binding transcription factors