PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v1.0, v2.0, v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV28288.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family Trihelix
Protein Properties Length: 284aa    MW: 33527 Da    PI: 8.582
Description Trihelix family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV28288.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1trihelix82.17.7e-2629111186
    trihelix   1 rWtkqevlaLiearremeerlrrgklkkplWeevskkmrergferspkqCkekwenlnkrykkikegekkrtsessstcpyfdqle 86 
                 +W+ qe+++L+ +r e++ ++ ++k++k lWe +s +m+e+g++rs+ qCk+kw+nl +ryk ++++e ++    ++++p++++l+
  KZV28288.1  29 QWSIQETRDLLMIRAELDPTFMETKRNKLLWEVISTRMKEKGYTRSADQCKCKWKNLVTRYKGCEAMEAEG---MRQQFPFYNDLQ 111
                 7********************************************************************97...56679****997 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
CDDcd122031.59E-232893No hitNo description
PfamPF138372.4E-2029112No hitNo description
PROSITE profilePS500907.3643086IPR017877Myb-like domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005730Cellular Componentnucleolus
GO:0016592Cellular Componentmediator complex
Sequence ? help Back to Top
Protein Sequence    Length: 284 aa     Download sequence    Send to blast
MDQGHHSQLH NPYSAALNID TGSGDRFPQW SIQETRDLLM IRAELDPTFM ETKRNKLLWE  60
VISTRMKEKG YTRSADQCKC KWKNLVTRYK GCEAMEAEGM RQQFPFYNDL QTIFATRMQR  120
MLWLEAEGGG ATASTPKKRK KTVQYSSSDE EDENEESEVE KGGGTRRKKI VNKGKETGNP  180
PAGTSSSNVC SIINGVKGIM EDYMKQQMEM EMQWIKTYEA REEERRAKEV EWRQKMEVLE  240
NERMMMERRW RERDEQRRIR EEARAERRDA LITALLNKLR REDM
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
2ebi_A3e-1330107784DNA binding protein GT-1
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1136140KKRKK
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011095020.11e-130PREDICTED: trihelix transcription factor GT-3b
SwissprotO804502e-70TGT3B_ARATH; Trihelix transcription factor GT-3b
TrEMBLA0A022RPD31e-118A0A022RPD3_ERYGU; Uncharacterized protein
STRINGPOPTR_0006s10240.11e-102(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA41872343
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38250.13e-55Trihelix family protein