PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV27501.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family bZIP
Protein Properties Length: 185aa    MW: 21494.8 Da    PI: 6.2792
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV27501.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_141.13.8e-1377135563
                 CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
      bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkkevaklksev 63 
                 ++ rr+++NRe+ArrsR RK++ ++eL   v  L +eN+ L ++l+  ++  +++ +e+
  KZV27501.1  77 RKRRRMISNRESARRSRMRKQKHLDELWSQVLRLRTENHNLVDRLNVVSESHDRVLQEN 135
                 5789**************************************99999988888777776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.4E-1573137IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.87575138IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.31E-1277126No hitNo description
PfamPF001703.4E-1177135IPR004827Basic-leucine zipper domain
Gene3DG3DSA:1.20.5.1705.5E-1177149No hitNo description
CDDcd147021.35E-2178129No hitNo description
PROSITE patternPS0003608095IPR004827Basic-leucine zipper domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 185 aa     Download sequence    Send to blast
MDYFLAHENS SNSHLTMQTN PTPFDHHFDK FLAHFPIHQT SLPMQEFAHN SSSVSNNSTS  60
DDADENQFSS GGIIDERKRR RMISNRESAR RSRMRKQKHL DELWSQVLRL RTENHNLVDR  120
LNVVSESHDR VLQENARLKE EATDLRGIVT ELQICNSYSI FKDLEDIPCN IAHGLNEYTC  180
NELSP
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
17680RKRRR
27697RKRRRMISNRESARRSRMRKQK
38996RRSRMRKQ
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor involved in somatic embryogenesis. Acts as positive regulator of BHLH109. {ECO:0000269|PubMed:26973252}.
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV27501.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011077776.13e-66basic leucine zipper 43
SwissprotQ9FMC25e-35BZP43_ARATH; Basic leucine zipper 43
TrEMBLA0A2Z7B0T21e-135A0A2Z7B0T2_9LAMI; Basic leucine-zipper 42
STRINGcassava4.1_022183m1e-63(Manihot esculenta)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA9472492
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G30530.15e-43basic leucine-zipper 42
Publications ? help Back to Top
  1. Nowak K,Gaj MD
    Stress-related function of bHLH109 in somatic embryo induction in Arabidopsis.
    J. Plant Physiol., 2016. 193: p. 119-26
    [PMID:26973252]
  2. Ezer D, et al.
    The G-Box Transcriptional Regulatory Code in Arabidopsis.
    Plant Physiol., 2017. 175(2): p. 628-640
    [PMID:28864470]