PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV27484.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CPP
Protein Properties Length: 747aa    MW: 83651.9 Da    PI: 6.1771
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV27484.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR505.9e-16455493240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag +C e C C dC+Nk 
  KZV27484.1 455 TCKRCNCKKSKCLKLYCECFAAGIYCMEPCACIDCFNKP 493
                 689**********************************96 PP

2TCR49.58.4e-16540578139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce CkN+
  KZV27484.1 540 RHKRGCNCKKSGCLKKYCECYQGGVGCSVNCRCERCKNT 578
                 589***********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.4E-18454495IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.044455580IPR005172CRC domain
PfamPF036387.3E-12457492IPR005172CRC domain
SMARTSM011149.0E-16540581IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-11542578IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 747 aa     Download sequence    Send to blast
MQESPIFDFL NSLSPIKPVK SIHVTQTINP FTFASLPSVL TSPHVGSLSR SRFVRWRQLY  60
DSSKFEFSCD DGSTVLINRT VENTSAKLGE HQENRDSRLF LGEIDGDPSY DISNIGAEFA  120
RCSDSKCSSP RCDIKVEQIE ECSTNSSTLF PFTQKPFQRD LCEIEVNLEG LCQADQNKEA  180
ISCDWENLMF DDPDLLKLES SNYNLLHNKP AYAEAIFRER SEGENMATLP DEGIEVLEIT  240
EPHDIFTSSR NNCNEKKDGD LKEFSSSISN SELDPLNLIQ QSCISILKIS GSYHERRRCC  300
LIFGTSESQI GHLEDNAGSD SSILQQSVGS TFLSDRHSVS TNMGNESSGC ILREMSLHRH  360
ALAVNQNDYK IDKNETSDSR RLLLGSCSSI SFNSSVADLE FQTNISEQES NTLENGVFPM  420
EDDGRVYGYA AAEEINQCTP KRKRFRSESP RDGETCKRCN CKKSKCLKLY CECFAAGIYC  480
MEPCACIDCF NKPVHIDTVL ATRKQIETRN PLAFAPKVIK ASDTRPESWE DLSKSPASAR  540
HKRGCNCKKS GCLKKYCECY QGGVGCSVNC RCERCKNTFG IKDGPCLTIM EADSEEDETN  600
LMEKNVLDIS LQKTDLRQNL GYAPSTSLQG IRQSVPHPYS TNKKTPTSSF PYNSSASSFY  660
ASQILRRPNF FQIPSRLDKR LQMVKEDDIP EFLQQGSSPI PCIKSVSPKR KRVLSPHSVG  720
QSSPSFRSSR KLVLQSIPSF PCLTSNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-1645757712120Protein lin-54 homolog
5fd3_B3e-1645757712120Protein lin-54 homolog
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV27484.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2Z7B1530.0A0A2Z7B153_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-112TESMIN/TSO1-like CXC 2