PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV27468.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CPP
Protein Properties Length: 543aa    MW: 58909.6 Da    PI: 7.9707
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV27468.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR44.23.7e-14125164242
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42 
                 + k+CnCk+s+Clk+YCeCf++g++C+  C+C +C+N+ e+
  KZV27468.1 125 KPKQCNCKHSRCLKLYCECFSSGTYCDG-CNCVNCHNNVEN 164
                 5699************************.********9875 PP

2TCR51.42.2e-16207246140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  KZV27468.1 207 KHNKGCHCKKSGCLKKYCECFQANILCSENCKCMDCKNYE 246
                 589***********************************87 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.1E-15124164IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163436.03125247IPR005172CRC domain
PfamPF036382.5E-11127161IPR005172CRC domain
SMARTSM011146.2E-20207248IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.5E-12210245IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 543 aa     Download sequence    Send to blast
MEQREGGEFL PKNRPSQSED SATPAAADFP ARKLVRQLDF TGLSGGASSG VHPQPHQVAA  60
SNHLSHPTQQ LSAKPPQVLY MSSQQPPRPP APPIHPTIRP LVKPESPRAR SRPNLNEAKD  120
GTPKKPKQCN CKHSRCLKLY CECFSSGTYC DGCNCVNCHN NVENEAARRE AVEATLERNP  180
NAFRPKIAGS PHGARDNRVL EGLITGKHNK GCHCKKSGCL KKYCECFQAN ILCSENCKCM  240
DCKNYEGSEE RQALFHGDHG NNIVYIQQAA NAAITGAIGS SGYGSPPLNK KRKGQELFFG  300
SITKDPVHML GHLQQANQIK GSGPSSSLSS LSGPQHGNVS ALGPSKFTYR SLLADIIQSQ  360
DVKELCSVLV VYGAEAAKML AEEKKPVENM PEICRETSLA TSSQDLSQSL KLSVTEEALI  420
DDPSSGNQNG NAKIESGFEG SDLSKGRPMS PSTLALICDE QDAMFPSTAS PNGLEGHNNV  480
LSQLSRDQGL TEAYPEQERI ILTTFRDCLN RLITLGNIKG KVHPLCFSFV PFASMSMNMI  540
ERI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-2812325610132Protein lin-54 homolog
5fd3_B3e-2812325610132Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV27468.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011078441.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-170TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A2G9GSN40.0A0A2G9GSN4_9LAMI; Metallothionein-like protein
STRINGXP_010105053.10.0(Morus notabilis)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24012455
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-141Tesmin/TSO1-like CXC domain-containing protein