PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV25101.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family FAR1
Protein Properties Length: 869aa    MW: 100038 Da    PI: 6.3446
Description FAR1 family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV25101.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1FAR184.12.3e-2668153288
        FAR1   2 fYneYAkevGFsvrkskskkskrngeitkrtfvCskegkreeekkktekerrtraetrtgCkaklkvkkekdgkwevtkleleHnHe 88 
                 fY++YA+ vGFsvrk+  ++sk +g++++r+f+Cs++g+r+++k++  + +++r+etrtgC a ++v+++ +gk++vt++e+eHnH+
  KZV25101.1  68 FYSRYAELVGFSVRKDWVNRSKVHGRVMSRKFTCSRQGHRKKDKRD-INVKKHRKETRTGCLAYMVVTRQPNGKYQVTQFEEEHNHN 153
                 9******************************************999.99999**********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF031012.0E-2368153IPR004330FAR1 DNA binding domain
PfamPF105511.8E-22278369IPR018289MULE transposase domain
PROSITE profilePS509669.149547594IPR007527Zinc finger, SWIM-type
PfamPF044341.5E-5564593IPR007527Zinc finger, SWIM-type
SMARTSM005756.5E-6569596IPR006564Zinc finger, PMZ-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 869 aa     Download sequence    Send to blast
MDRIEDESVR NHEDRMDLRM SNSLDLNVEH NCHTLKSNTN GVNSAGYSKD KALKLGMEFV  60
SDEQAYFFYS RYAELVGFSV RKDWVNRSKV HGRVMSRKFT CSRQGHRKKD KRDINVKKHR  120
KETRTGCLAY MVVTRQPNGK YQVTQFEEEH NHNDVDLIKA EKLLEFPLCG NWESTEVSES  180
DSMKTKSKLS IQLLGIRLCA PEKFDDLQSE TENIFLSTER TRDMKEGDAA RLLYYFQRQH  240
FINPAFFYSI QLDIDDKITN IFWAYDNTII DYGHFGDVVC LDTTAIRNKD SRPFVQFVGL  300
NHHRQVVVFG AALLYDDTVD TFKWLFQTFV ETMSGKKPKF ILSDQDATIV QAIHALLPET  360
SHLMCAWQMY LIALKHLCHL IIEHDSFASD FRNCIFAHEQ EDEFILAWDS MLEKHGLRQN  420
SWLKWMFREK ENWAATYGKN TFFIESNGKH LVEQMSDKFR SYLCPDLDIL QFLKHFESVV  480
NEQKYSELEA AFQTQRQAPV LMANAVLLKY PGEIYTPKAF EVFQMEYEKC LNTIINKSGE  540
QDSKFDYKVR TYGKSKDFLV VYNSLDCTAS CNCLKFEHVG FLCSHALKVL DHHNVKVVPS  600
CYILKRWTKD ARILPIGEND GHTEEDNRKI IATRYKDLCR NMIKISARAA ESDSAFEFAA  660
RQLDEVMQGV ESILNFKSFE NIRGTPASEN APAIVGLDSN GFEDQDANVL QETVETESLV  720
PTDELNHYDE QVPRASGGID GHPSPSRTVL SVACAPSAYI SSPVPAPTLS PITQVLYSVE  780
ANHVVQRMYQ ASNLTINHQS NPNMYEPQSF YSNQHSPSHS HILQETLICN QFQDSMSNGT  840
QMKQLVDDGQ LTHASSFMHY SRRYRAADV
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV25101.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101183.10.0protein FAR1-RELATED SEQUENCE 5
RefseqXP_011101184.10.0protein FAR1-RELATED SEQUENCE 5
TrEMBLA0A2Z7AT610.0A0A2Z7AT61_9LAMI; Uncharacterized protein
STRINGMigut.F01137.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA43522109
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G38180.17e-99FAR1-related sequence 5