PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV23929.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CPP
Protein Properties Length: 765aa    MW: 84327.2 Da    PI: 5.6373
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV23929.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR50.34.6e-16475513240
         TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 ++k+CnCkkskClk+YCeCfaag++C e C C dC+Nk 
  KZV23929.1 475 SCKRCNCKKSKCLKLYCECFAAGVYCVEPCACIDCFNKP 513
                 689**********************************96 PP

2TCR51.32.4e-16560598139
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNk 39 
                 ++k+gCnCkks ClkkYCeC++ g+ Cs +C+Ce+CkN 
  KZV23929.1 560 RHKRGCNCKKSGCLKKYCECYQGGVGCSINCRCEGCKNV 598
                 589***********************************6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.7E-18474515IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163437.038475600IPR005172CRC domain
PfamPF036386.7E-12477512IPR005172CRC domain
SMARTSM011143.8E-18560601IPR033467Tesmin/TSO1-like CXC domain
PfamPF036386.3E-12562597IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 765 aa     Download sequence    Send to blast
MGEGCEDFAK EYNGEEKEVM DTPERSKSNQ IATSVCKFEE SPVFSFLNNL SPIKPVKSVH  60
ITQTINPLSF ATLPSVFTSP HVSSLRRSRF LRRHHFSDPS KPEFSCDDAN TVDLNKVNNV  120
GNEKFDEQEK LDPEASHCMV AGQPSYECSN KFAEKYDCDP NSRKSPVKSS CGLESTSSLI  180
VYESEVNLEE AGQTDENKEC LSCDWESLMA DDSDLLIFES PNDTGNKKLC GTEMSFYTTI  240
RNDKLNMQSL VAMYSGEQIG EGSQPENLSF HPGEGTGMTE HSEKHDMTTS SLINDSTEEM  300
DHEHISGLYR GMRRRCLVFE MAGGHRQRFE ETSAPDASVV LQSGSDTSNN NRQLVPINTT  360
ESPRCVVPTL GLHLNAIGTT AKDCKLVHVK PSASGTLLIG PSPSVDFHPP TTGKELSNNL  420
DISSLERDIG TIEDFVPLTE EDSCQASGYG ANEEITQSSP KKKKRRLEQA GEGESCKRCN  480
CKKSKCLKLY CECFAAGVYC VEPCACIDCF NKPVHEGTVL ATRKQIESRN PLAFAPKVIR  540
GSDSLTETGD DSSNTPASAR HKRGCNCKKS GCLKKYCECY QGGVGCSINC RCEGCKNVFG  600
RKDGSVLIDT EAEYEEDETD TTEKNMREKT AVHIDSEPHM DSAPPETPLL AGRNPVQQHL  660
LSNKKPPRSS FPCIGSSSRS YVNQVFKKPS FQPAPKLDRH FETIKEDEIP EFLQEGSPIS  720
GIKLSSPNSK RVSPPHNVGT TTGLRSSRKL ILQSIPSFPS LTHNQ
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A1e-1847759812121Protein lin-54 homolog
5fd3_B1e-1847759812121Protein lin-54 homolog
Search in ModeBase
Nucleic Localization Signal ? help Back to Top
NLS
No. Start End Sequence
1459465PKKKKRR
2459466PKKKKRRL
3460465KKKKRR
4461465KKKRR
5461466KKKRRL
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00624PBMTransfer from PK22848.1Download
Motif logo
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV23929.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011090684.10.0LOW QUALITY PROTEIN: protein tesmin/TSO1-like CXC 2
TrEMBLA0A2Z7AWU60.0A0A2Z7AWU6_9LAMI; Uncharacterized protein
STRINGMigut.G00370.1.p0.0(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA24672345
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G14770.11e-128TESMIN/TSO1-like CXC 2