PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV18613.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family G2-like
Protein Properties Length: 401aa    MW: 45253.6 Da    PI: 9.7382
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV18613.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.3e-3186139255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 prlrWtp+LH +F++a+e+LGG+e+AtPk++l+lm+vkgL+++hvkSHLQ+YR 
  KZV18613.1  86 PRLRWTPDLHLSFIHAIERLGGQERATPKSVLQLMNVKGLSISHVKSHLQMYRG 139
                 8****************************************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.8E-2982139IPR009057Homeodomain-like
PROSITE profilePS5129410.53482142IPR017930Myb domain
SuperFamilySSF466892.69E-1484139IPR009057Homeodomain-like
TIGRFAMsTIGR015578.9E-2386140IPR006447Myb domain, plants
PfamPF002491.9E-887138IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 401 aa     Download sequence    Send to blast
MDDEKMTTGS RDDDMETEQN KLSSDSSENI SSINLNEEAG SNTSIDDQAI EFSSNGEEIK  60
HEDSLKSAEG DEKKSAVRQY IRSKMPRLRW TPDLHLSFIH AIERLGGQER ATPKSVLQLM  120
NVKGLSISHV KSHLQMYRGK KLDESGKVIG QPSRFYSIPG RRYHLSGTAF GKFSPLHHLR  180
LQNGGIVLAQ GTDHGDRLRN SSHNSQSYPL EIKSLTSRFQ RWSSDNQEPK VRTNSRVITE  240
VNKQNKPIPS SIQSTEERYR TGPLRPNRFL EDRRWPPREE ILKTQFKEQK IPMSSILASA  300
VSQNFKSQPR WNFIDRSTGI CQQKSSFISE NSTLPLTIDS SLPVNETKEE KRIKGTDRLP  360
AGSDLQLSLS LSTNNSKDQK ACMKGGDSDI NTMLSLALTP H
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A1e-1787138354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-1787138354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-1787138354Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-1787138354Protein PHOSPHATE STARVATION RESPONSE 1
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV18613.1
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011101395.11e-117myb-related protein 2
RefseqXP_020546992.11e-117myb-related protein 2
TrEMBLA0A2Z7AAB60.0A0A2Z7AAB6_9LAMI; Uncharacterized protein
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA55162334
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G38300.12e-36G2-like family protein