PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZV14429.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family CPP
Protein Properties Length: 487aa    MW: 53841.3 Da    PI: 6.1144
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZV14429.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR49.48.8e-163473342
         TCR  3 kkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                +k+CnCkks+Clk+YC+Cfaag +C+e C C+ C N+ e+
  KZV14429.1 34 CKRCNCKKSRCLKLYCDCFAAGIYCAEPCACQACLNRPEH 73
                79**********************************9875 PP

2TCR34.25.2e-11123153131
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeC 31 
                 ++k+gCnCkks ClkkYCeC++++ + + +C
  KZV14429.1 123 RHKRGCNCKKSMCLKKYCECYQENFYLAIQC 153
                 589********************99988877 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011144.3E-153273IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163427.8833165IPR005172CRC domain
PfamPF036381.8E-113570IPR005172CRC domain
SMARTSM011144.4E-9123190IPR033467Tesmin/TSO1-like CXC domain
PfamPF036382.2E-5125148IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 487 aa     Download sequence    Send to blast
MHPCGDIVCI IKQESIILQF SRKKISESSD GDGCKRCNCK KSRCLKLYCD CFAAGIYCAE  60
PCACQACLNR PEHVDTVLET RQQIETRNPL AFAPKVVQHV TEPPASNCGL EEDATHFTPS  120
SARHKRGCNC KKSMCLKKYC ECYQENFYLA IQCFLSLIVC EEVHFPSFGK ANVGCSDGCR  180
CEGCKNVFGQ KGEFGMTKDV LSDEESNEIQ DASLVSNSNI MASEDAVRHT EFCSPYNSTP  240
FTPAFQYLNH EKDASKAWFP SGRYFVSPEP GLPSVPPFLA SPKSPRSSDN DTMSETTKEI  300
LDLVSFDLES DYGNVETGNE ISESHQEPGK TTLVSHRPDS QGWTNNLILQ SSSRNVPYSS  360
VKPSRFHGSP NTPVSNLSGT KHQELLDLDH DLFDVMQDDT PEILKDTPTP LNAVKVSSPN  420
KKRVSPPHSQ VPKFDSSSPA RFRNAVKFIL KSVPSFPPLT PCINPKNGSF EQSGNSQNCS  480
GSDQDHE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A6e-133718714121Protein lin-54 homolog
5fd3_B6e-133718714121Protein lin-54 homolog
Search in ModeBase
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZV14429.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011081944.11e-163protein tesmin/TSO1-like CXC 2
TrEMBLA0A2Z6ZZ220.0A0A2Z6ZZ22_9LAMI; Uncharacterized protein
STRINGMigut.E01471.1.p1e-142(Erythranthe guttata)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA69802128
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22780.17e-57Tesmin/TSO1-like CXC domain-containing protein