PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID KZT76517.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; lamiids; Lamiales; Gesneriaceae; Didymocarpoideae; Trichosporeae; Loxocarpinae; Dorcoceras
Family GRAS
Protein Properties Length: 89aa    MW: 10055.1 Da    PI: 11.1825
Description GRAS family protein
Gene Model
Gene Model ID Type Source Coding Sequence
KZT76517.1genomeCNUView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1GRAS49.67.3e-16247586137
        GRAS  86 evsPilkfshltaNqaIleavegeervHiiDfdisqGlQWpaLlqaLasRpe 137
                 +  P+++++++t  qaIle v++++++H iDf+i  G++W  ++q La+R++
  KZT76517.1  24 QKLPCIQITQFTVIQAILEIVASAKKIHLIDFGIRSGMHWSVMMQGLANRRN 75 
                 567**********************************************986 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5098514.262189IPR005202Transcription factor GRAS
PfamPF035142.5E-132475IPR005202Transcription factor GRAS
Sequence ? help Back to Top
Protein Sequence    Length: 89 aa     Download sequence    Send to blast
MERKTSAVGD IMLKFHPAVL AAEQKLPCIQ ITQFTVIQAI LEIVASAKKI HLIDFGIRSG  60
MHWSVMMQGL ANRRNCTVKT RKFSSKKKK
Cis-element ? help Back to Top
SourceLink
PlantRegMapKZT76517.1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_011071651.19e-28DELLA protein RGL1-like
TrEMBLA0A2Z6ZTI06e-59A0A2Z6ZTI0_9LAMI; Uncharacterized protein
STRINGXP_006419398.18e-18(Citrus clementina)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA85001728
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G03450.11e-11RGA-like 2