PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca8735.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family YABBY
Protein Properties Length: 137aa    MW: 15139.3 Da    PI: 7.944
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca8735.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY63.21e-191077169
      YABBY  1 advfssseqvCyvqCnfCntilavsvPstslfkvvtvrCGhCtsllsvnlakasqllaaeshldeslke 69
               +d+ s +e++Cyv+Cn+Cnt+lav +P + l+++vtv+CGhC ++  ++ +   q +   +h + +l+ 
  Dca8735.1 10 MDLASPPEHLCYVRCNYCNTVLAVVIPCKRLMETVTVKCGHCGNVSFLSTRPPLQGQCLDHH-QVTLQG 77
               578899*************************************9977666655544443333.333332 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046902.2E-2015100IPR006780YABBY protein
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
Sequence ? help Back to Top
Protein Sequence    Length: 137 aa     Download sequence    Send to blast
MNNMEEKVNM DLASPPEHLC YVRCNYCNTV LAVVIPCKRL METVTVKCGH CGNVSFLSTR  60
PPLQGQCLDH HQVTLQGYNF MDKPTESLCG TTTSNGDQQH KRGQPSSSSS SASTEPVSPR  120
PFVVKRICTS PPFTYTL
Functional Description ? help Back to Top
Source Description
UniProtRegulates carpel specification in flower development. Severe or intermediate mutation in DL causes complete or partial homeotic conversion of carpels into stamens without affecting the identities of other floral organs. Interacts antagonistically with class B genes and controls floral meristem determinacy. Regulates midrib formation in leaves probably by inducing cell proliferation in the central region of the leaf. {ECO:0000269|PubMed:14729915}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680651.16e-58PREDICTED: protein CRABS CLAW
RefseqXP_010680652.16e-58PREDICTED: protein CRABS CLAW
SwissprotQ76EJ08e-27YABDL_ORYSJ; Protein DROOPING LEAF
TrEMBLB9REB64e-40B9REB6_RICCO; Protein CRABS CLAW, putative
STRINGXP_010680651.12e-57(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G69180.16e-26YABBY family protein