PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca7442.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 291aa    MW: 32742.6 Da    PI: 4.592
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca7442.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260117.11.1e-3610107198
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallk 98 
                aCaaCk++rrkC+++C+lapyfp ++pk f+nvhklFG+++++kll+al+++ r++am+s++yeA+ r r P  G++gvi++lq  l++ ++el +++
  Dca7442.1  10 ACAACKYQRRKCTPECPLAPYFPPDRPKMFQNVHKLFGVKKIQKLLTALHPSCRNEAMNSIIYEADLRDRFPATGSLGVIHRLQDLLAKCQQELYAVN 107
                7*******************************************************************************************998776 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089123.3959110IPR004883Lateral organ boundaries, LOB
PfamPF031952.8E-3510106IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009556Biological Processmicrosporogenesis
GO:0009786Biological Processregulation of asymmetric cell division
GO:0005634Cellular Componentnucleus
Sequence ? help Back to Top
Protein Sequence    Length: 291 aa     Download sequence    Send to blast
MTLKGGTSQA CAACKYQRRK CTPECPLAPY FPPDRPKMFQ NVHKLFGVKK IQKLLTALHP  60
SCRNEAMNSI IYEADLRDRF PATGSLGVIH RLQDLLAKCQ QELYAVNSMV AMYRQQQMSS  120
EVSLLADIDV ASQLQLGMAP TSKEEEPAFC IHDPPVSEEH NSDNVMAVTQ DYSFSGSNSP  180
YNSNYLDTKV MMNSMWIQNS GNNDTNNSEN DHAVPIQSQL ITSQEPGAEQ EDFQKYDEMR  240
HYFDTIDDRQ SYITTSCSLD YDEMDAAQCH EQVAENELKN AAACFSLTSV N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A3e-2661207121LOB family transfactor Ramosa2.1
5ly0_B3e-2661207121LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010678608.16e-98PREDICTED: LOB domain-containing protein 27-like
TrEMBLA0A2C9UJM38e-87A0A2C9UJM3_MANES; Uncharacterized protein
STRINGXP_010678608.12e-97(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G47870.12e-43LOB domain-containing protein 27