PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca60722.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 243aa    MW: 27578 Da    PI: 8.0678
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca60722.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like89.72.6e-28118171155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kprl W+ eLH++Fv+av++L G+ekA Pk+il++m+v+gLt+e+v+SHLQkYRl
  Dca60722.1 118 KPRLFWSVELHQKFVDAVNSL-GIEKAFPKKILDMMNVEGLTREKVASHLQKYRL 171
                 79*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011014.789142IPR001789Signal transduction response regulator, receiver domain
SuperFamilySSF521721.85E-8348IPR011006CheY-like superfamily
Gene3DG3DSA:3.40.50.23001.2E-11349No hitNo description
Gene3DG3DSA:3.40.50.23001.2E-1199110No hitNo description
Gene3DG3DSA:1.10.10.603.4E-29115176IPR009057Homeodomain-like
PROSITE profilePS5129411.109115174IPR017930Myb domain
SuperFamilySSF466894.48E-19115175IPR009057Homeodomain-like
TIGRFAMsTIGR015575.6E-23118171IPR006447Myb domain, plants
PfamPF002493.9E-7123170IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 243 aa     Download sequence    Send to blast
MTVLSSYSDT KRVMQGIRNG ACDYLVKPVR IQELQNIWQH VVRRNKSITL KRPPPSSIEL  60
QVNNEEFNQN NYYVHDVPCE KRKCKILEEN SSRGDDMNDD DEQEDSGRDN EESTQPKKPR  120
LFWSVELHQK FVDAVNSLGI EKAFPKKILD MMNVEGLTRE KVASHLQKYR LYLRKVNDGT  180
DEASSKISAY ENGNIGPLGG GYGVFQSLAG TTTRYPGINQ SLLHPAMFGR LNTVAGANLA  240
YQH
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A1e-22114177164ARR10-B
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010687814.13e-78PREDICTED: two-component response regulator ARR12
TrEMBLA0A0K9QUN49e-72A0A0K9QUN4_SPIOL; Two-component response regulator
STRINGXP_010687814.11e-77(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G58080.12e-46response regulator 18