PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca60054.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 263aa    MW: 29340.8 Da    PI: 10.6783
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca60054.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like91.95.4e-29211260251
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ
  Dca60054.1 211 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQ 260
                 9************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.29E-13208261IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.602.9E-25209260IPR009057Homeodomain-like
TIGRFAMsTIGR015578.6E-22211262IPR006447Myb domain, plants
PfamPF002498.1E-6212260IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 263 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNAK PSTTGPAQPE LDLSFWKRAS DTTSRTIIKP SSEIDPSTTL  60
INHHQLSSTG GPTTPSSNTN LLHHFHQQQQ QRYQQLLHHH HNHQHAAAGV SGGGLGPEMG  120
FLKPIRGIPV YQNPPHMSFP FAPQPLDSSS TAINVGSILG NNTTNNNNNN ISYSNQSHQH  180
NNFHHHHHNH QGMMRSRFLS RFPAKRSMRA PRMRWTSTLH ARFVHAVELL GGHERATPKS  240
VLELMDVKDL TLAHVKSHLQ VTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J5e-14212260452Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010663129.19e-73PREDICTED: probable transcription factor KAN2 isoform X1
SwissprotQ9C6161e-55KAN2_ARATH; Probable transcription factor KAN2
TrEMBLF6HT563e-71F6HT56_VITVI; Uncharacterized protein
STRINGVIT_02s0012g01940.t014e-72(Vitis vinifera)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G16560.11e-39G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]