PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca58130.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 201aa    MW: 22759.9 Da    PI: 8.5043
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca58130.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.62.7e-333185155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprlrWt eLHerFv+av+qLGG++kAtPk+il++m+vkgLtl h+kSHLQkYRl
  Dca58130.1 31 KPRLRWTAELHERFVDAVTQLGGPNKATPKAILRTMGVKGLTLFHLKSHLQKYRL 85
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.608.7E-322886IPR009057Homeodomain-like
PROSITE profilePS5129412.572888IPR017930Myb domain
TIGRFAMsTIGR015577.9E-253186IPR006447Myb domain, plants
SuperFamilySSF466892.33E-173187IPR009057Homeodomain-like
PfamPF002498.8E-93384IPR001005SANT/Myb domain
PfamPF143791.0E-15130174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 201 aa     Download sequence    Send to blast
MDEMHHHQIV GPMTHNTQTG DPRLVLTSDP KPRLRWTAEL HERFVDAVTQ LGGPNKATPK  60
AILRTMGVKG LTLFHLKSHL QKYRLGKQSG KDMIGDASKD GITAMYQLES PRTSNSSTSL  120
PTSDMDEGYK VKEALRTQME VQTKLHLQVE AEKHLQLRQD AERRYMAMLE RACKILTDQL  180
MEVSISDNHT HPLQGHTSDL N
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4r_A3e-203187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B3e-203187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C3e-203187157Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D3e-203187157Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator (PubMed:26586833). Probable component of the central regulatory system controlling transcriptional responses to Pi starvation (PubMed:26586833). Binds in a sequence-specific manner to phosphate starvation-regulated promoters (PubMed:26586833). Required for female gametophyte development and function (PubMed:15634699). {ECO:0000269|PubMed:15634699, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated in roots by low Pi. {ECO:0000269|PubMed:26586833}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021749031.11e-111protein PHR1-LIKE 2-like isoform X1
SwissprotQ8LAJ73e-63PHL3_ARATH; Protein PHR1-LIKE 3
TrEMBLA0A0K9RJS61e-107A0A0K9RJS6_SPIOL; Uncharacterized protein (Fragment)
STRINGXP_010673278.11e-107(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G13640.11e-65G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Sanz-Fernández M, et al.
    Screening Arabidopsis mutants in genes useful for phytoremediation.
    J. Hazard. Mater., 2017. 335: p. 143-151
    [PMID:28441590]