PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca57219.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 273aa    MW: 30338.3 Da    PI: 10.3895
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca57219.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32156209255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 pr+rWt++LH+rFv+ave LGG+e+AtPk++lelm+vk+Ltl+hvkSHLQ+YR+
  Dca57219.1 156 PRMRWTSTLHARFVHAVELLGGHERATPKSVLELMDVKDLTLAHVKSHLQMYRT 209
                 9****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466891.2E-15153209IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.608.6E-29154209IPR009057Homeodomain-like
TIGRFAMsTIGR015575.3E-24156209IPR006447Myb domain, plants
PfamPF002493.9E-7157208IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009944Biological Processpolarity specification of adaxial/abaxial axis
GO:0010158Biological Processabaxial cell fate specification
GO:0010229Biological Processinflorescence development
GO:0048481Biological Processplant ovule development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 273 aa     Download sequence    Send to blast
MELFPAQPDL SLQISPPNAK PKPKPKPIVT SAQIDLTLTP NHNHHHHHNH HHQQPFYHGG  60
LGPELGFLRP IRGIPVYQNP PPPSFPFASP SPSSSAATCN PIAGLHNGGG VGTVTTNNHH  120
HHHHQNHHVS SYHHHQGMMR SRFLSRFPAK RSMRAPRMRW TSTLHARFVH AVELLGGHER  180
ATPKSVLELM DVKDLTLAHV KSHLQMYRTV KTTDRAAASP GQGDAYENGS SGDNTSDDVF  240
ARKHGCMAIN LEISKEMACN VNLLLRKKWT QNA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-16157211357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-16157211357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-16157211357Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-16157211357Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J4e-16157211458Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable transcription factor that regulates lateral organ polarity. Promotes abaxial cell fate during lateral organd formation. Functions with KAN1 in the specification of polarity of the ovule outer integument. {ECO:0000269|PubMed:11525739, ECO:0000269|PubMed:15286295, ECO:0000269|PubMed:16623911, ECO:0000269|PubMed:17307928}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00174DAPTransfer from AT1G32240Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_022756946.13e-82probable transcription factor KAN2 isoform X2
SwissprotQ9C6163e-61KAN2_ARATH; Probable transcription factor KAN2
TrEMBLA0A151RAF27e-82A0A151RAF2_CAJCA; Putative Myb family transcription factor At1g14600 family
STRINGAES957831e-78(Medicago truncatula)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G32240.19e-60G2-like family protein
Publications ? help Back to Top
  1. Machida C,Nakagawa A,Kojima S,Takahashi H,Machida Y
    The complex of ASYMMETRIC LEAVES (AS) proteins plays a central role in antagonistic interactions of genes for leaf polarity specification in Arabidopsis.
    Wiley Interdiscip Rev Dev Biol, 2015 Nov-Dec. 4(6): p. 655-71
    [PMID:26108442]