PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca5473.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 254aa    MW: 27396.2 Da    PI: 8.9892
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca5473.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF2601322.5e-41341331100
     DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallkee 100
                +CaaCk+lrr+Ca++C+++pyf  ++p+kfa vhk+FGasnv+kll ++pe++r da++slvyeA++r+rdPvyG++g i++lqqql+ l+ael+++++e
  Dca5473.1  34 PCAACKLLRRRCAQECPFSPYFSPHEPHKFASVHKVFGASNVSKLLMEVPENQRADAANSLVYEANVRLRDPVYGCMGAISALQQQLQVLQAELNAIRTE 133
                7**********************************************************************************************99876 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.59533134IPR004883Lateral organ boundaries, LOB
PfamPF031952.2E-4134131IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0016020Cellular Componentmembrane
Sequence ? help Back to Top
Protein Sequence    Length: 254 aa     Download sequence    Send to blast
MAAALVAQQG GGGGGGRRQM QLGTTPGVLN TITPCAACKL LRRRCAQECP FSPYFSPHEP  60
HKFASVHKVF GASNVSKLLM EVPENQRADA ANSLVYEANV RLRDPVYGCM GAISALQQQL  120
QVLQAELNAI RTEILKFKFR DINNNNNNNN NNNNINVSNI TANDNNTNNS NNSNSNNNNN  180
AATSHVSFFS TTPGVVTLAT QSSPPPPPPA PPLRDPQNSS VSSSMYTQQQ RQRQPSGGSN  240
DYSSISNENI SYFG
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A1e-45241444121LOB family transfactor Ramosa2.1
5ly0_B1e-45241444121LOB family transfactor Ramosa2.1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00283DAPTransfer from AT2G30340Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_027338654.11e-81LOB domain-containing protein 15
SwissprotQ9AT619e-68LBD13_ARATH; LOB domain-containing protein 13
TrEMBLA0A2P5AHJ82e-79A0A2P5AHJ8_TREOI; Wilm's tumor protein
STRINGXP_009369256.13e-79(Pyrus x bretschneideri)
STRINGXP_004307714.13e-79(Fragaria vesca)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G40470.15e-68LOB domain-containing protein 15
Publications ? help Back to Top
  1. Cho C,Jeon E,Pandey SK,Ha SH,Kim J
    LBD13 positively regulates lateral root formation in Arabidopsis.
    Planta, 2019. 249(4): p. 1251-1258
    [PMID:30627888]