PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca54682.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 325aa    MW: 36260.4 Da    PI: 5.2773
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca54682.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like100.79.5e-32222277156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+ eLH+rFv+a+++LGG+++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Dca54682.1 222 KQRRCWSAELHRRFVDALTKLGGAQVATPKQIRELMGVDGLTNDEVKSHLQKYRLH 277
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466897.53E-17219278IPR009057Homeodomain-like
PROSITE profilePS5129413.623219279IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-28221279IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-26222277IPR006447Myb domain, plants
PfamPF002492.7E-7224275IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 325 aa     Download sequence    Send to blast
MDLHMKPHTN SDIDTNTDAI HTFLKQLPFI ADADVDVSLR RDDVNGFVAL LEAEFLKIHA  60
FQRELPLSTL LLKHVIQVLK QEASQHPTYR DADQPLVLEE FIPLEKVSGI GNTDIKRADV  120
DDDNDDGEKD ECGSDKKNWM SSVQLWTTAT MEDAKPSDNM STSNNMSTTL KESRKLEKED  180
AREHELSLVI PRKINHLNEQ RDVKSGGTTT LLHSSSPSTF RKQRRCWSAE LHRRFVDALT  240
KLGGAQVATP KQIRELMGVD GLTNDEVKSH LQKYRLHAGR VANKSATGEY SESAKPSSSQ  300
SLSPDGPLQF PGSAADDSMD AEDNI
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021731712.12e-75transcription factor HHO6-like
TrEMBLA0A0K9RTL51e-63A0A0K9RTL5_SPIOL; Uncharacterized protein
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G25550.13e-37G2-like family protein