PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca54024.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 460aa    MW: 50768.2 Da    PI: 4.9362
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca54024.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.82.5e-33265319155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kpr+rWtpeLHe+Fv+ v++LGGse+AtPk +l+lm+v+gLt++hvkSHLQkYR+
  Dca54024.1 265 KPRMRWTPELHESFVDSVNKLGGSERATPKGVLRLMNVEGLTIYHVKSHLQKYRT 319
                 79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.3E-31262320IPR009057Homeodomain-like
PROSITE profilePS512949.932262322IPR017930Myb domain
SuperFamilySSF466893.58E-17263319IPR009057Homeodomain-like
TIGRFAMsTIGR015575.0E-24265319IPR006447Myb domain, plants
PfamPF002492.7E-8267318IPR001005SANT/Myb domain
PfamPF143794.6E-21351396IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 460 aa     Download sequence    Send to blast
MKMNMHSAFP IPTTGGNCSS SPMQTPGGKC FTDLKPSLPF SSPLPSLTNP LEDFPSSPDP  60
FVLSSSREMI ASSHIQTNPI VSHIGSSHNE VPYVSGFQTD MHFPSFPSCE RQPQSSQFLS  120
QTSGSVAHYH NTPLDIQTTG FINYQKDDDD NSWSTSQLQD LLDFPVGLPA SNTQVGNNTE  180
VVSSDDHIKR ITWKEFTDED LYVDNLEPNW NEFLADSNVV DQQPKVPQSS SDIVTPKPSV  240
QQQLSLPSRE VSASANSAST AQSNKPRMRW TPELHESFVD SVNKLGGSER ATPKGVLRLM  300
NVEGLTIYHV KSHLQKYRTA RVRPESCEGN SENKSSATEQ VSPVDLKTSI TITEALRMQM  360
EVQKQLHEQL EIQRKLQLQI EEQGKCLLQM LESQNKAEKE KTNPGPSNVD DPSTQASVEQ  420
SHGLKGKQKL AEGSGGSDQQ PEDDGSDPPP VKRARIDELL
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-30265323260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021738038.10.0myb family transcription factor PHL13-like
RefseqXP_021738039.10.0myb family transcription factor PHL13-like
TrEMBLQ9M6200.0Q9M620_MESCR; CDPK substrate protein 1
STRINGXP_010675144.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.18e-79G2-like family protein