PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca4973.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family CPP
Protein Properties Length: 456aa    MW: 49300.6 Da    PI: 6.8555
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca4973.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR51.12.6e-16323362241
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkee 41 
                ++k+CnCkkskClk+YCeCfaag +C ++C+C+dC+Nk +
  Dca4973.1 323 SCKHCNCKKSKCLKLYCECFAAGIYCVQNCNCQDCFNKPS 362
                689**********************************986 PP

2TCR48.91.3e-15408446240
        TCR   2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                +k+gC+Ckks C+kkYCeCf+ g+ Cs +C+Ce+CkN+ 
  Dca4973.1 408 SKRGCQCKKSGCVKKYCECFQVGVGCSLSCRCESCKNTF 446
                689**********************************85 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.2E-17322363IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163433.983323447IPR005172CRC domain
PfamPF036385.0E-12325360IPR005172CRC domain
SMARTSM011145.1E-15407448IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.1E-11409445IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 456 aa     Download sequence    Send to blast
MKRGCANLQS DVGSSGSMKP DCGFDVSGTD VLPSKVIEGD SMEVVPPPEN RTDMEIPERE  60
HIKEGCEEKT LICDVSNIFN SNSPTKGSHH ERQHERNVDS GIPSLITEVI QNPNGPYSEP  120
PLKASEIHKE AVDIHETNQL PDGKADGVLA EEAIHFAKTD SDGKLSTQKQ QNTNIGCLVN  180
EMSGSHYRQL LSNPSGCSPI SNSSTSFKTI KKCLVANKPG HSKSLSLFPD IGLHLNAVAT  240
AGGDKLIGTK SSVTCESNLL SSPCTSPSSN PSDGLERDCE VRKDDAPQTG NICEKSTFGE  300
CGISQSFLEN KRIKTECVGE TDSCKHCNCK KSKCLKLYCE CFAAGIYCVQ NCNCQDCFNK  360
PSHVDTVIAT RRLIESRNPL AFAPKVIVCS DTPSNANTIN MTAVSARSKR GCQCKKSGCV  420
KKYCECFQVG VGCSLSCRCE SCKNTFGRKE GQLLFE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A2e-1332544412120Protein lin-54 homolog
5fd3_B2e-1332544412120Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtProbable floral-specific cell division component, required for proper organ formation in flowers. Regulates the floral meristem cell division and the inflorescence meristem organization. Plays a role in development of both male and female reproductive tissues. {ECO:0000269|PubMed:10769244, ECO:0000269|PubMed:10769245, ECO:0000269|PubMed:9043081, ECO:0000269|PubMed:9725857}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
SwissprotQ9LUI32e-64TSO1_ARATH; CRC domain-containing protein TSO1
STRINGXP_010675092.11e-123(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G22760.15e-48Tesmin/TSO1-like CXC domain-containing protein
Publications ? help Back to Top
  1. Lu T,Dou Y,Zhang C
    Fuzzy clustering of CPP family in plants with evolution and interaction analyses.
    BMC Bioinformatics, 2013. 14 Suppl 13: p. S10
    [PMID:24268301]
  2. Xie W, et al.
    Exploring potential new floral organ morphogenesis genes of Arabidopsis thaliana using systems biology approach.
    Front Plant Sci, 2015. 6: p. 829
    [PMID:26528302]
  3. Wang W,Sijacic P,Xu P,Lian H,Liu Z
    Arabidopsis TSO1 and MYB3R1 form a regulatory module to coordinate cell proliferation with differentiation in shoot and root.
    Proc. Natl. Acad. Sci. U.S.A., 2018. 115(13): p. E3045-E3054
    [PMID:29535223]