PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca49267.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family CPP
Protein Properties Length: 525aa    MW: 57465.3 Da    PI: 7.9476
Description CPP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca49267.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1TCR45.12e-145594242
         TCR  2 ekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNkeek 42
                +++ CnCk+s+Clk+YCeCfa+g++C+  C+C++C+N+ e+
  Dca49267.1 55 RQRLCNCKHSRCLKLYCECFASGVYCDG-CNCNNCSNNVEN 94
                5788************************.********9875 PP

2TCR50.34.9e-16135174140
         TCR   1 kekkgCnCkkskClkkYCeCfaagkkCseeCkCedCkNke 40 
                 k++kgC+Ckks ClkkYCeCf+a+  Cse+CkC dCkN e
  Dca49267.1 135 KHNKGCHCKKSVCLKKYCECFQANIVCSENCKCIDCKNFE 174
                 589***********************************65 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM011142.5E-145494IPR033467Tesmin/TSO1-like CXC domain
PROSITE profilePS5163434.09755175IPR005172CRC domain
PfamPF036384.4E-115791IPR005172CRC domain
SMARTSM011142.7E-19135176IPR033467Tesmin/TSO1-like CXC domain
PfamPF036381.2E-12138173IPR005172CRC domain
Sequence ? help Back to Top
Protein Sequence    Length: 525 aa     Download sequence    Send to blast
MEEEREIDRS SPAQPPDTSS SQLPCETPSV STLKPESPRA QPLLNIDNKD VAAKRQRLCN  60
CKHSRCLKLY CECFASGVYC DGCNCNNCSN NVENESSRRE AVEATLERNS KAFKPKVASR  120
PNDTGAEAGE VIVGKHNKGC HCKKSVCLKK YCECFQANIV CSENCKCIDC KNFEGSEDRH  180
ALLLGDHPNN STYMKQEANA AITGAIGSSG FTFMSIPRKR KSDEPQSNDL SALNGRQFRQ  240
ANHIRQSGPS GVSSTSASRA ANSSLPNATK FAYRSLLADI IKPQDVKELC SVLVVLSEEA  300
AKTIAETKNN NEKRGVNGLE TSITPSSQNT LQRRDESDRK AEPGDWLGGN DTGKIGYDDS  360
NLDGNDISKS RPMSPLTLAL RCDEQDTSFT TSGCCDELAN DVRKCPQLAG QSTTETEEYA  420
KQELIVLTKF RDCLNRLISY GELKETKCLS LARSTSVSYQ ANANRTAEAR TDRYNQREPL  480
CNGAAKSVIP VTAPNRNSAM LAATISTVPT SKIIPRNPLQ LKRPF
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5fd3_A3e-27501835131Protein lin-54 homolog
5fd3_B3e-27501835131Protein lin-54 homolog
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtPlays a role in development of both male and female reproductive tissues. {ECO:0000250}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00045PBMTransfer from AT4G29000Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021862324.10.0protein tesmin/TSO1-like CXC 5
SwissprotQ9SZD11e-150TCX5_ARATH; Protein tesmin/TSO1-like CXC 5
TrEMBLA0A0K9QRU40.0A0A0K9QRU4_SPIOL; Uncharacterized protein
STRINGXP_010688245.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G29000.11e-130Tesmin/TSO1-like CXC domain-containing protein