PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca46780.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 794aa    MW: 88173.8 Da    PI: 8.5875
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca46780.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like986.8e-312377155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprl+Wtp LH+rF++a++qLGG+ekAtPk++++lm+++gLtl+h+kSHLQkYRl
  Dca46780.1 23 KPRLKWTPLLHQRFIHAINQLGGPEKATPKSLMRLMGIPGLTLYHLKSHLQKYRL 77
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.602.0E-282178IPR009057Homeodomain-like
SuperFamilySSF466899.68E-152279IPR009057Homeodomain-like
TIGRFAMsTIGR015573.7E-212378IPR006447Myb domain, plants
PfamPF002491.0E-62576IPR001005SANT/Myb domain
PfamPF143794.5E-22128174IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene3DG3DSA:3.50.50.605.0E-84304432IPR023753FAD/NAD(P)-binding domain
SuperFamilySSF519055.04E-46306589IPR023753FAD/NAD(P)-binding domain
PfamPF007323.1E-31315596IPR000172Glucose-methanol-choline oxidoreductase, N-terminal
Gene3DG3DSA:3.50.50.605.0E-84478603IPR023753FAD/NAD(P)-binding domain
PROSITE patternPS006240555569IPR000172Glucose-methanol-choline oxidoreductase, N-terminal
SuperFamilySSF543731.09E-16631735No hitNo description
PfamPF051995.7E-26650779IPR007867Glucose-methanol-choline oxidoreductase, C-terminal
Gene3DG3DSA:3.50.50.605.0E-84660674IPR023753FAD/NAD(P)-binding domain
Gene3DG3DSA:3.50.50.605.0E-84730789IPR023753FAD/NAD(P)-binding domain
SuperFamilySSF519055.04E-46734788IPR023753FAD/NAD(P)-binding domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0055114Biological Processoxidation-reduction process
GO:0003677Molecular FunctionDNA binding
GO:0016614Molecular Functionoxidoreductase activity, acting on CH-OH group of donors
GO:0050660Molecular Functionflavin adenine dinucleotide binding
Sequence ? help Back to Top
Protein Sequence    Length: 794 aa     Download sequence    Send to blast
MGDENNNVES SEEMRLVLST DAKPRLKWTP LLHQRFIHAI NQLGGPEKAT PKSLMRLMGI  60
PGLTLYHLKS HLQKYRLGKN NQQSESCKNL KHENVDNKVN LNELNLLYED NNDVNGMNGD  120
HQIQENAHVA QAIQLQMEVQ RKLHEQLEVQ RHLQMRIEAQ GKYLQKVLKK AHETLSIYNC  180
PTLGVENAKA ELSQLVSMVS TSSFSGLTET QDLFPESHLS QKCTARSARC SVESSLTSSE  240
SSERVADNER DTAKFGQETS PLIMSLLDKG ETKGLSSRKR SRSGTCEGIF VQEKGIEAQL  300
PYMTSNASEI KGKSFDYIII GGGASGCALA ATLSEKFTVL VIERGGSPYK DPTILERTKF  360
GFPMIQTNKF TSVAQEFVSE DGIVNYRGRV LGGSTAINSG FYSRASCEFI KKMKWDENMV  420
KQAYEWVESK LVYPPFLSPW QSTVLDGLLE AGVLPFNGYT LEHVQGTKLS GTLFDVFEKR  480
HTAADLLASG NVKNIVVLLN ATASKIMFHR NGKKPRAYGV KFIKSEGSTN ETYKVYLKKN  540
DDNSSIKGEV ILSAGALGSP QLLMLSGIGP SSHLQKYNIP IVSNLEQVGA KMQDNPSISL  600
LVDNKPKWRV PDTPQVTGIA ENYTIIIESI IVPISHNLSR VSIAGKVANP ESRGVLELKG  660
KDPRENPLVK FNYLVEKADM EACLRIQEVV GRVSMSKWVG MYLGEEHNEF KKLGEEESKE  720
YCKKHVGTFY HYHGGCVVGL VVDEGYKVYG VKGLRVIDGS TLVESPGTNP MANLMMLGRY  780
QGLKIIEKRM SSLS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1ju2_A1e-10330979222520hydroxynitrile lyase
1ju2_B1e-10330979222520hydroxynitrile lyase
3gdn_A1e-10330979222520R-oxynitrile lyase isoenzyme 1
3gdn_B1e-10330979222520R-oxynitrile lyase isoenzyme 1
3gdp_A1e-10330979222520R-oxynitrile lyase isoenzyme 1
3gdp_B1e-10330979222520R-oxynitrile lyase isoenzyme 1
3red_A1e-10330979222521Hydroxynitrile lyase
3red_B1e-10330979222521Hydroxynitrile lyase
3red_C1e-10330979222521Hydroxynitrile lyase
3red_D1e-10330979222521Hydroxynitrile lyase
3red_E1e-10330979222521Hydroxynitrile lyase
3red_F1e-10330979222521Hydroxynitrile lyase
3red_G1e-10330979222521Hydroxynitrile lyase
3red_H1e-10330979222521Hydroxynitrile lyase
3red_I1e-10330979222521Hydroxynitrile lyase
3red_J1e-10330979222521Hydroxynitrile lyase
3red_K1e-10330979222521Hydroxynitrile lyase
3red_L1e-10330979222521Hydroxynitrile lyase
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010683167.10.0PREDICTED: protein HOTHEAD isoform X2
TrEMBLA0A0K9RTS60.0A0A0K9RTS6_SPIOL; Uncharacterized protein
STRINGXP_010683166.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.34e-59G2-like family protein