PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca42700.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 309aa    MW: 34059.5 Da    PI: 6.1339
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca42700.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like105.33.5e-3398152155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 k r+rWtpeLHe+Fv+av++LGGse+AtPk ++ +m+v+gLt++hvkSHLQkYR+
  Dca42700.1  98 KSRMRWTPELHEAFVDAVNHLGGSERATPKGVVSHMNVEGLTIYHVKSHLQKYRS 152
                 68****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129414.20995155IPR017930Myb domain
SuperFamilySSF466891.27E-1796152IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.0E-3096153IPR009057Homeodomain-like
TIGRFAMsTIGR015572.6E-2498152IPR006447Myb domain, plants
PfamPF002491.1E-9100151IPR001005SANT/Myb domain
PfamPF143792.8E-20184226IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 309 aa     Download sequence    Send to blast
MGQLQDLLDF PDGLSLSNDN HVKGIWSELA DEDLYADTVE PNWNEFLGNS NVGDQQQKVP  60
QSSSDAAAPK TSVQQQVSLP TREVSASANS TSSAQPNKSR MRWTPELHEA FVDAVNHLGG  120
SERATPKGVV SHMNVEGLTI YHVKSHLQKY RSARIKQESS EGNAENRTSA AEQASPVDLK  180
TSITITEALR MQMQVQKQLH EQLEIQRKLQ LQIEEQGKYL LQMLGSHNKL ETEKSVSGPS  240
KVDHSSSDVK SEPDLRTTYQ AAGENSDSHG LKGKQKFTDS SVVSNQHSQD DGAAPRVTKV  300
AKIDNSLRY
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-2898156260Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675144.11e-115PREDICTED: myb family transcription factor PHL13
SwissprotF4J3P72e-66PHLD_ARATH; Myb family transcription factor PHL13
TrEMBLQ9M6201e-119Q9M620_MESCR; CDPK substrate protein 1
STRINGXP_010675144.11e-114(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04450.28e-69G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]