PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca36007.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 295aa    MW: 32701 Da    PI: 7.0079
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca36007.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like90.71.3e-28238288151
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51 
                 k r+rWt+eLHe+Fve+v++LGG+ekAtPk+il+lm+ +gLt+ hvkSHLQ
  Dca36007.1 238 KSRIRWTTELHEKFVECVNRLGGAEKATPKAILKLMNSDGLTIFHVKSHLQ 288
                 68************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466898.24E-15236289IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.606.6E-25236288IPR009057Homeodomain-like
TIGRFAMsTIGR015576.2E-21238289IPR006447Myb domain, plants
PfamPF002493.0E-8242288IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 295 aa     Download sequence    Send to blast
MSHQRNDFHG QVMNDCTTEF VNVRQSWSIG ACLGDGVSNT VPGPNVSSTI MNRYSPPLLP  60
GERFVGSLPY HEQQISSPTF SSAVQSSKNY DQDYRSYPGS TKDGFSVELA DNQDGSDFRS  120
RTALESAAKA LLYGDQNQFY GSEKIYDNNS HNNNSPCGDY SGNVQTQQIH NKFLLDFVNL  180
DARSYSFSTN EKQDFRFFDK SYMLPHGELS FSIQPGKQAP SSVGVGSLSS SRATISNKSR  240
IRWTTELHEK FVECVNRLGG AEKATPKAIL KLMNSDGLTI FHVKSHLQVS ISSTN
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A1e-20238288151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B1e-20238288151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C1e-20238288151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D1e-20238288151Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-20238288252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021770386.11e-100myb family transcription factor PHL5-like
TrEMBLA0A0K9RV663e-89A0A0K9RV66_SPIOL; Uncharacterized protein
STRINGXP_010672678.11e-95(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G06800.25e-28G2-like family protein