PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca34823.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 206aa    MW: 22393.1 Da    PI: 9.6563
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca34823.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.31.9e-293685251
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                prlrWtp+LH++Fv+a+++LGG++kAtPk +l+lm+v gLt++hvkSHLQ
  Dca34823.1 36 PRLRWTPDLHRCFVHAIDRLGGQHKATPKLVLQLMDVRGLTISHVKSHLQ 85
                8************************************************9 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.603.2E-273285IPR009057Homeodomain-like
PROSITE profilePS5129412.3833292IPR017930Myb domain
SuperFamilySSF466894.66E-133485IPR009057Homeodomain-like
TIGRFAMsTIGR015572.2E-213685IPR006447Myb domain, plants
PfamPF002492.5E-63785IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MERSGTSNKS CGNSHSGGGG GGGSGGVRQY VRSKVPRLRW TPDLHRCFVH AIDRLGGQHK  60
ATPKLVLQLM DVRGLTISHV KSHLQGAMAN VQPQKQAHHR YNSESHDTFG RRHKTVSIEV  120
EKELAEKTIM GDKRRSNESE GLSLTLSLQP TLSPLLVGKG SNVSSTNVSE ISEQAISSNS  180
STSTAWDEHV HHPLNLDLSI SLCSME
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J6e-173785452Protein PHOSPHATE STARVATION RESPONSE 1
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_016574578.11e-36PREDICTED: putative Myb family transcription factor At1g14600 isoform X1
RefseqXP_016574579.11e-36PREDICTED: putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A1U8H0J83e-35A0A1U8H0J8_CAPAN; Uncharacterized protein
TrEMBLA0A1U8H2E33e-35A0A1U8H2E3_CAPAN; putative Myb family transcription factor At1g14600 isoform X2
TrEMBLA0A2G2ZH633e-35A0A2G2ZH63_CAPAN; putative Myb family transcription factor At1g14600 isoform X1
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G02060.17e-33G2-like family protein