PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca32697.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 136aa    MW: 15531.6 Da    PI: 5.0301
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca32697.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like88.65.7e-283184255
     G2-like  2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +r+rWt+eLHe+F +av+qLGG e+AtP  +l++m+v+gLt++hv+ HL kYR+
  Dca32697.1 31 QRMRWTQELHEAFADAVSQLGGRERATPEDVLRVMNVEGLTIYHVRRHLLKYRI 84
                8****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.3832787IPR017930Myb domain
Gene3DG3DSA:1.10.10.608.6E-252985IPR009057Homeodomain-like
SuperFamilySSF466891.68E-132984IPR009057Homeodomain-like
TIGRFAMsTIGR015574.1E-193184IPR006447Myb domain, plants
PfamPF002491.6E-93283IPR001005SANT/Myb domain
PfamPF143792.0E-6117136IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 136 aa     Download sequence    Send to blast
EPLSLAELVV PRLEIQEQLS LLSTAEVSTT QRMRWTQELH EAFADAVSQL GGRERATPED  60
VLRVMNVEGL TIYHVRRHLL KYRIASIRPE LSEGNADDEM TDSAQESPVD LKTNITTTKA  120
LRMQIKLQKQ LHEQLE
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J8e-243288460Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor involved in phosphate starvation signaling (PubMed:11511543, PubMed:17927693, PubMed:26586833). Binds as a dimer to P1BS, an imperfect palindromic sequence 5'-GNATATNC-3', to promote the expression of inorganic phosphate (Pi) starvation-responsive genes (PubMed:11511543, PubMed:20838596, PubMed:26586833). SPX1 is a competitive inhibitor of this DNA-binding (PubMed:25271326). PHR1 binding to its targets is low Pi-dependent (PubMed:25271326). Regulates the expression of miR399 (PubMed:20838596). Regulates the expression of IPS1 (At3g09922), a non-coding RNA that mimics the target of miR399 to block the cleavage of PHO2 under Pi-deficient conditions (PubMed:17643101). Regulates lipid remodeling and triacylglycerol accumulation during phosphorus starvation (PubMed:25680792). Required for the shoot-specific hypoxic response (PubMed:24753539). Regulates FER1 expression upon phosphate starvation, linking iron and phosphate homeostasis (PubMed:23788639). Contributes to the homeostasis of both sulfate and phosphate in plants under phosphate deficiency (PubMed:21261953). Required for adaptation to high light and retaining functional photosynthesis during phosphate starvation (PubMed:21910737). Involved in the coregulation of Zn and Pi homeostasis (PubMed:24420568). {ECO:0000269|PubMed:11511543, ECO:0000269|PubMed:17643101, ECO:0000269|PubMed:17927693, ECO:0000269|PubMed:20838596, ECO:0000269|PubMed:21261953, ECO:0000269|PubMed:21910737, ECO:0000269|PubMed:23788639, ECO:0000269|PubMed:24420568, ECO:0000269|PubMed:24753539, ECO:0000269|PubMed:25271326, ECO:0000269|PubMed:25680792, ECO:0000269|PubMed:26586833}.
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Only moderately up-regulated by Pi starvation. {ECO:0000269|PubMed:11511543}.
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010675144.19e-45PREDICTED: myb family transcription factor PHL13
SwissprotQ94CL72e-35PHR1_ARATH; Protein PHOSPHATE STARVATION RESPONSE 1
TrEMBLQ9M6203e-41Q9M620_MESCR; CDPK substrate protein 1
STRINGXP_010675144.13e-44(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G28610.17e-38phosphate starvation response 1
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Matsui K,Togami J,Mason JG,Chandler SF,Tanaka Y
    Enhancement of phosphate absorption by garden plants by genetic engineering: a new tool for phytoremediation.
    Biomed Res Int, 2013. 2013: p. 182032
    [PMID:23984322]
  3. Jost R, et al.
    Differentiating phosphate-dependent and phosphate-independent systemic phosphate-starvation response networks in Arabidopsis thaliana through the application of phosphite.
    J. Exp. Bot., 2015. 66(9): p. 2501-14
    [PMID:25697796]
  4. Zhou Z, et al.
    SPX proteins regulate Pi homeostasis and signaling in different subcellular level.
    Plant Signal Behav, 2015. 10(9): p. e1061163
    [PMID:26224365]
  5. Bonnot C, et al.
    A chemical genetic strategy identify the PHOSTIN, a synthetic molecule that triggers phosphate starvation responses in Arabidopsis thaliana.
    New Phytol., 2016. 209(1): p. 161-76
    [PMID:26243630]
  6. Khan GA,Vogiatzaki E,Glauser G,Poirier Y
    Phosphate Deficiency Induces the Jasmonate Pathway and Enhances Resistance to Insect Herbivory.
    Plant Physiol., 2016. 171(1): p. 632-44
    [PMID:27016448]
  7. Velasco VM, et al.
    Acclimation of the crucifer Eutrema salsugineum to phosphate limitation is associated with constitutively high expression of phosphate-starvation genes.
    Plant Cell Environ., 2016. 39(8): p. 1818-34
    [PMID:27038434]
  8. Yong-Villalobos L, et al.
    Phosphate starvation induces DNA methylation in the vicinity of cis-acting elements known to regulate the expression of phosphate-responsive genes.
    Plant Signal Behav, 2016. 11(5): p. e1173300
    [PMID:27185363]
  9. Li Y,Wu H,Fan H,Zhao T,Ling HQ
    Characterization of the AtSPX3 Promoter Elucidates its Complex Regulation in Response to Phosphorus Deficiency.
    Plant Cell Physiol., 2016. 57(8): p. 1767-78
    [PMID:27382128]
  10. Zhang H,Huang L,Hong Y,Song F
    BOTRYTIS-INDUCED KINASE1, a plasma membrane-localized receptor-like protein kinase, is a negative regulator of phosphate homeostasis in Arabidopsis thaliana.
    BMC Plant Biol., 2016. 16(1): p. 152
    [PMID:27389008]
  11. Yuan J, et al.
    Systematic characterization of novel lncRNAs responding to phosphate starvation in Arabidopsis thaliana.
    BMC Genomics, 2016. 17: p. 655
    [PMID:27538394]
  12. Linn J, et al.
    Root Cell-Specific Regulators of Phosphate-Dependent Growth.
    Plant Physiol., 2017. 174(3): p. 1969-1989
    [PMID:28465462]
  13. Aleksza D,Horváth GV,Sándor G,Szabados L
    Proline Accumulation Is Regulated by Transcription Factors Associated with Phosphate Starvation.
    Plant Physiol., 2017. 175(1): p. 555-567
    [PMID:28765275]
  14. Liu Y, et al.
    Light and Ethylene Coordinately Regulate the Phosphate Starvation Response through Transcriptional Regulation of PHOSPHATE STARVATION RESPONSE1.
    Plant Cell, 2017. 29(9): p. 2269-2284
    [PMID:28842534]
  15. Qi W,Manfield IW,Muench SP,Baker A
    AtSPX1 affects the AtPHR1-DNA-binding equilibrium by binding monomeric AtPHR1 in solution.
    Biochem. J., 2017. 474(21): p. 3675-3687
    [PMID:28887383]
  16. Huang KL, et al.
    The ARF7 and ARF19 Transcription Factors Positively Regulate PHOSPHATE STARVATION RESPONSE1 in Arabidopsis Roots.
    Plant Physiol., 2018. 178(1): p. 413-427
    [PMID:30026290]
  17. Jiang M, et al.
    Structural basis for the Target DNA recognition and binding by the MYB domain of phosphate starvation response 1.
    FEBS J., 2019.
    [PMID:30974511]