PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca32558.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 206aa    MW: 23541.6 Da    PI: 7.3807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca32558.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like47.83.2e-156352655
     G2-like 26 kAtPktilelmkvkgLtlehvkSHLQkYRl 55
                +A+Pk+ilelm+v+gLt+e+v+SHLQkYR 
  Dca32558.1  6 EAVPKKILELMNVPGLTRENVASHLQKYRQ 35
                69***************************5 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
TIGRFAMsTIGR015574.1E-13635IPR006447Myb domain, plants
Gene3DG3DSA:1.10.10.608.7E-14638IPR009057Homeodomain-like
SuperFamilySSF466891.43E-7738IPR009057Homeodomain-like
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 206 aa     Download sequence    Send to blast
MVVNVEAVPK KILELMNVPG LTRENVASHL QKYRQCHKQL ERPFLQKRGN KVKLIPLQEQ  60
SHISISPTNG HPNIQTQTQV ISTSSLQVRS FPTQIDLYGN HETLKHMTHA MKIQAMSNES  120
MVFGENSSSK TDMNMAIVKH VEGSNVIYHP WSTTFSREDN VNKEATSFFA REQCVNYGYG  180
YENLLDLGYN DAPFCFEQID HNSYAH
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G16857.22e-12response regulator 1