PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca32147.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 363aa    MW: 40570.3 Da    PI: 6.2524
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca32147.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like93.51.6e-29142194255
     G2-like   2 prlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +rl+Wtp+LH+rFve+v++L G+++A+Pkti++lm+v+gLt+e+v+SHLQkYRl
  Dca32147.1 142 ARLVWTPQLHKRFVEVVAHL-GIKNAVPKTIMQLMNVEGLTRENVASHLQKYRL 194
                 79******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.868138197IPR017930Myb domain
SuperFamilySSF466897.35E-19139198IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.2E-29139198IPR009057Homeodomain-like
TIGRFAMsTIGR015572.0E-23142194IPR006447Myb domain, plants
PfamPF002493.8E-8144193IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007623Biological Processcircadian rhythm
GO:0009909Biological Processregulation of flower development
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 363 aa     Download sequence    Send to blast
MGEVNGNFNG VINGGDDSDR VHEWEAGLPN FEDITPLSHG LIPPELLSAF NITPEPYRTS  60
GDVAQASQQT ISSIRGSNFG NVVGKEVVVV VDEVMDEDDG DVDDLDGVSP EKKSRRNFSP  120
EDADSAAAAA DDAADEKAAK RARLVWTPQL HKRFVEVVAH LGIKNAVPKT IMQLMNVEGL  180
TRENVASHLQ KYRLYLKRNQ GYSLENGQSN SSQATNVQAN HSNNLQNHHQ QQQHQHHHHQ  240
SNNHQYNYNQ NNNYNNQHNQ YQYSNGVMQT GNNNMYGSSV VYHQNHHLNH NYPPHVAPDY  300
EPGKERQNFL SKFGLGDAFR EMTNSYGDAS DVRSNIGLRI AYISSGVFLS VVIYGKIYLS  360
LYA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A4e-32141197157Transcription factor LUX
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor that is a critical component of the regulatory circuit of the circadian clock. Binds to specific sites on CCA1 promoter leading to CCA1 activation. Is required for the rhythmic expression of other clock genes such as LHY, GI and APRR1/TOC1. {ECO:0000269|PubMed:21447790}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021715378.12e-73transcription factor PCL1-like
RefseqXP_021715379.12e-73transcription factor PCL1-like
RefseqXP_021715380.12e-73transcription factor PCL1-like
SwissprotQ9LTH42e-59PCLL_ARATH; Transcription factor BOA
TrEMBLA0A0K9RZP82e-66A0A0K9RZP8_SPIOL; Uncharacterized protein
STRINGXP_010685710.19e-71(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G59570.12e-47G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]