PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30161.2
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 418aa    MW: 46829.8 Da    PI: 7.7042
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30161.2genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.24.3e-343589155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprl+Wtp+LHerFveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Dca30161.2 35 KPRLKWTPDLHERFVEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 89
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.8493292IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.3E-323390IPR009057Homeodomain-like
SuperFamilySSF466894.84E-173490IPR009057Homeodomain-like
TIGRFAMsTIGR015573.5E-233590IPR006447Myb domain, plants
PfamPF002496.5E-103788IPR001005SANT/Myb domain
PfamPF143792.2E-9134156IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
PfamPF143798.0E-10193218IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 418 aa     Download sequence    Send to blast
MYQSPRTPAH SDRQLFLQGV SGPRDSNLVL STDAKPRLKW TPDLHERFVE AVNQLGGADK  60
ATPKTVMKLM GIPGLTLYHL KSHLQKYRLS KNIHGQANSG TNSKPVVTTS DRIPETSPQH  120
TSNINTMQPT NKNIHINEAL QMQIEVQRRL HEQLEVLDPV YFPISQTGLS PKAETTSAAQ  180
KLQRQHPKNS CGVQRRLQLR IEAQGKYLQG VLEKAQETLG KQNIGAVGLE AAKHQLSELV  240
SKVSDQCLNL AFTEIVEEQQ GVHPHHQTQQ TNMLTNCSTE SCLTSCDGHV AHKREQEIPQ  300
NALGLRPYSG DTRFLDIQDL NDTTKDHAAA LFPMMTQPDP EKLLFQVEKA CNDLTMCVGI  360
KRERPNNVEK SANSHRTTDT FQLDSQYKLA SFSTDLDLNT RHEPDGIRHL DLNGLSWA
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010672721.10.0PREDICTED: myb-related protein 2-like isoform X2
TrEMBLA0A0K9RSG60.0A0A0K9RSG6_SPIOL; Uncharacterized protein
STRINGXP_010672720.10.0(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-103G2-like family protein