PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca30161.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 381aa    MW: 42849.3 Da    PI: 7.3112
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca30161.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like108.43.7e-343589155
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55
                kprl+Wtp+LHerFveav+qLGG++kAtPkt+++lm+++gLtl+h+kSHLQkYRl
  Dca30161.1 35 KPRLKWTPDLHERFVEAVNQLGGADKATPKTVMKLMGIPGLTLYHLKSHLQKYRL 89
                79****************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129410.8493292IPR017930Myb domain
Gene3DG3DSA:1.10.10.603.8E-323390IPR009057Homeodomain-like
SuperFamilySSF466894.3E-173490IPR009057Homeodomain-like
TIGRFAMsTIGR015573.1E-233590IPR006447Myb domain, plants
PfamPF002495.7E-103788IPR001005SANT/Myb domain
PfamPF143793.3E-24134181IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 381 aa     Download sequence    Send to blast
MYQSPRTPAH SDRQLFLQGV SGPRDSNLVL STDAKPRLKW TPDLHERFVE AVNQLGGADK  60
ATPKTVMKLM GIPGLTLYHL KSHLQKYRLS KNIHGQANSG TNSKPVVTTS DRIPETSPQH  120
TSNINTMQPT NKNIHINEAL QMQIEVQRRL HEQLEVQRRL QLRIEAQGKY LQGVLEKAQE  180
TLGKQNIGAV GLEAAKHQLS ELVSKVSDQC LNLAFTEIVE EQQGVHPHHQ TQQTNMLTNC  240
STESCLTSCD GHVAHKREQE IPQNALGLRP YSGDTRFLDI QDLNDTTKDH AAALFPMMTQ  300
PDPEKLLFQV EKACNDLTMC VGIKRERPNN VEKSANSHRT TDTFQLDSQY KLASFSTDLD  360
LNTRHEPDGI RHLDLNGLSW A
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-213491158Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscriptional activator that may activate the transcription of specific genes involved in nitrogen uptake or assimilation (PubMed:15592750). Acts redundantly with MYR1 as a repressor of flowering and organ elongation under decreased light intensity (PubMed:21255164). Represses gibberellic acid (GA)-dependent responses and affects levels of bioactive GA (PubMed:21255164). {ECO:0000269|PubMed:21255164, ECO:0000305|PubMed:15592750}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00331DAPTransfer from AT3G04030Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by nitrogen deficiency. {ECO:0000269|PubMed:15592750}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021740906.10.0myb-related protein 2-like isoform X3
SwissprotQ9SQQ91e-109PHL9_ARATH; Myb-related protein 2
TrEMBLA0A0K9RQP51e-176A0A0K9RQP5_SPIOL; Uncharacterized protein
STRINGXP_010672720.11e-175(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G04030.31e-111G2-like family protein
Publications ? help Back to Top
  1. Duarte JM, et al.
    Expression pattern shifts following duplication indicative of subfunctionalization and neofunctionalization in regulatory genes of Arabidopsis.
    Mol. Biol. Evol., 2006. 23(2): p. 469-78
    [PMID:16280546]
  2. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  3. Nakano Y,Naito Y,Nakano T,Ohtsuki N,Suzuki K
    NSR1/MYR2 is a negative regulator of ASN1 expression and its possible involvement in regulation of nitrogen reutilization in Arabidopsis.
    Plant Sci., 2017. 263: p. 219-225
    [PMID:28818378]