PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29702.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 322aa    MW: 36192.8 Da    PI: 6.5994
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29702.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like102.82.1e-32192247156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+peLH+rF++a+e+LGGs++AtPk+i+elm+v+gLt+++vkSHLQkYRl+
  Dca29702.1 192 KQRRCWSPELHRRFIDALEKLGGSQVATPKQIRELMQVDGLTNDEVKSHLQKYRLH 247
                 79****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:1.10.10.604.6E-29189250IPR009057Homeodomain-like
PROSITE profilePS5129414.987189249IPR017930Myb domain
SuperFamilySSF466891.79E-18190250IPR009057Homeodomain-like
TIGRFAMsTIGR015577.0E-27192247IPR006447Myb domain, plants
PfamPF002491.8E-8194245IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 322 aa     Download sequence    Send to blast
MVCSLPELSL DLSPPSVKFQ FPEFLTDFPA THVGDSCELF KLVEFIDELE EEIKKIQAFQ  60
RELPLSHTLL NHAIEQLKEK VKKCEKSWAK NGKFGENFGL NLGNHNDVIE KKDWMSSVQL  120
WAPSNNNEEK KVEGVSTNVS FKEDEKAPRL SLVTPSVVDQ GCNVSRTVGE STVNQSGKLQ  180
TTKQVCQTGS RKQRRCWSPE LHRRFIDALE KLGGSQVATP KQIRELMQVD GLTNDEVKSH  240
LQKYRLHIRK PQASNSKTPP SVDQMMGGET LELGYSNSDI QHSCSPEGMS HYVVSKKCNS  300
YSINGDEEEN SDGQTSKAPR LI
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A4e-14192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B4e-14192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C4e-14192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D4e-14192245154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J3e-14192245255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010680444.12e-88PREDICTED: myb family transcription factor EFM
TrEMBLA0A0K9R7613e-77A0A0K9R761_SPIOL; Uncharacterized protein
STRINGXP_010680444.18e-88(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G37180.11e-46G2-like family protein