PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca29105.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 271aa    MW: 29405.3 Da    PI: 6.2807
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca29105.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like95.34.8e-30122175155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +prl+Wtp LH+rFv+++e+L G+ekA+Pkti+e+m+v+gLt+e+v+SHLQkYRl
  Dca29105.1 122 RPRLVWTPHLHKRFVDVIEHL-GIEKAVPKTIMEMMNVDGLTRENVASHLQKYRL 175
                 59*******************.********************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SuperFamilySSF466899.32E-20120179IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.605.5E-30121180IPR009057Homeodomain-like
TIGRFAMsTIGR015576.4E-25123175IPR006447Myb domain, plants
PfamPF002497.3E-7125174IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0042753Biological Processpositive regulation of circadian rhythm
GO:0005634Cellular Componentnucleus
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 271 aa     Download sequence    Send to blast
MEDQWEMGLP SIEDLTPLTQ SLISPELASA FGITPENCRG LIDLNRASHD TCSTICPKED  60
SSFDGMGLRL FSGGAHFMDN GKMKRGESLL PDEANSGSGS GSGSGSKDEN GDENGLNRAV  120
KRPRLVWTPH LHKRFVDVIE HLGIEKAVPK TIMEMMNVDG LTRENVASHL QKYRLYLKRM  180
DGLANEGHSV SRKPLSFFDC EGFGSMSTPM PVILPPSHVG GSLPLVPMPL PGPSYGHLGL  240
GLGDHHSVPP PGFNCGLESG PFNTFWNRQR G
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5lxu_A1e-31122178157Transcription factor LUX
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00014PBMTransfer from AT3G46640Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021769031.11e-108transcription factor PCL1-like
TrEMBLA0A0K9QM927e-97A0A0K9QM92_SPIOL; Uncharacterized protein
STRINGXP_010690987.15e-97(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G46640.23e-57G2-like family protein