PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca28114.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 458aa    MW: 50473 Da    PI: 5.8502
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca28114.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like99.52.4e-31232286155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 +pr+rWtpeLHe Fv+av++L G+ekAtPk +l+lm+v+g+t++hvkSHLQkYR+
  Dca28114.1 232 RPRMRWTPELHELFVDAVNKLDGAEKATPKGVLKLMNVEGVTIYHVKSHLQKYRV 286
                 59****************************************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS512949.668229289IPR017930Myb domain
Gene3DG3DSA:1.10.10.601.5E-29230287IPR009057Homeodomain-like
SuperFamilySSF466893.58E-17231286IPR009057Homeodomain-like
TIGRFAMsTIGR015572.9E-23233286IPR006447Myb domain, plants
PfamPF002494.5E-8234285IPR001005SANT/Myb domain
PfamPF143795.5E-23325370IPR025756MYB-CC type transcription factor, LHEQLE-containing domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 458 aa     Download sequence    Send to blast
MNNIGRTSLI THESRKGTTV VQTSLPPAGL SYVDKCQSPV FKKSSYPSTF KKSEKSEVSN  60
EAAPSHASMF CTNLYLSSSS SSEAQRQFGK HPFLPTPSTP STSSVQSTKP ELLVQDDSDS  120
LYEQRQSEDS FRDFLNYPGN SSDGDYDDVT CGSDSFALNE QLELQLLSDE LHFAMTDGGE  180
NPGIDEIYEV SPIASKPAEA AAVHDTAKSV SLPTSVNAVS SQKVPVNSAT HRPRMRWTPE  240
LHELFVDAVN KLDGAEKATP KGVLKLMNVE GVTIYHVKSH LQKYRVAKYI PEKKEEKKTS  300
SSEEKKSQLN SKLCDASHAS SKGSITEALR MQMEVQKQLH EQLEVQRQLQ MRIEEHARYL  360
QKILEEQQKT RCTLVSTQSL QSTTSGEQEH DPHPASPPSP ESPAKPVESK TDSSSSLPLK  420
HQTDSHDSLE LQPCQKKPCV ELNPSASSDA YAVDVDST
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J1e-25232289259Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00354DAPTransfer from AT3G13040Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010696145.11e-170PREDICTED: myb family transcription factor PHL6
SwissprotQ949U21e-105PHL6_ARATH; Myb family transcription factor PHL6
TrEMBLA0A0K9QTS51e-166A0A0K9QTS5_SPIOL; Uncharacterized protein
STRINGXP_010696145.11e-169(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT3G13040.22e-76G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]
  2. Nguyen HT, et al.
    A Transcription Factor γMYB1 Binds to the P1BS cis-Element and Activates PLA2-γ Expression with its Co-Activator γMYB2.
    Plant Cell Physiol., 2016. 57(4): p. 784-97
    [PMID:26872838]