PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca25592.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 93aa    MW: 10198.8 Da    PI: 10.2732
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca25592.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like98.74e-314292151
     G2-like  1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQ 51
                kprlrWtp+LH+rFv+av++LGG++kAtPk++l+lm++kgLtl+h+kSHLQ
  Dca25592.1 42 KPRLRWTPDLHQRFVDAVSKLGGPDKATPKSVLKLMGMKGLTLYHLKSHLQ 92
                79************************************************* PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.6423993IPR017930Myb domain
Gene3DG3DSA:1.10.10.604.7E-293992IPR009057Homeodomain-like
SuperFamilySSF466892.33E-144292IPR009057Homeodomain-like
TIGRFAMsTIGR015571.5E-224293IPR006447Myb domain, plants
PfamPF002491.5E-94492IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0003677Molecular FunctionDNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 93 aa     Download sequence    Send to blast
MESGLGGVYG GSQGGSGVGY PYQFHHQHQL MEGGIIMSRD PKPRLRWTPD LHQRFVDAVS  60
KLGGPDKATP KSVLKLMGMK GLTLYHLKSH LQV
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A2e-204292151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B2e-204292151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C2e-204292151Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D2e-204292151Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J2e-204292252Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021725593.17e-38myb family transcription factor PHL11-like
RefseqXP_021862386.15e-38myb family transcription factor PHL11
SwissprotC0SVS42e-32PHLB_ARATH; Myb family transcription factor PHL11
TrEMBLA0A2I4H7R84e-33A0A2I4H7R8_JUGRE; myb family transcription factor PHL11
STRINGXP_010677471.17e-34(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G45580.11e-32G2-like family protein
Publications ? help Back to Top
  1. Petridis A,Döll S,Nichelmann L,Bilger W,Mock HP
    Arabidopsis thaliana G2-LIKE FLAVONOID REGULATOR and BRASSINOSTEROID ENHANCED EXPRESSION1 are low-temperature regulators of flavonoid accumulation.
    New Phytol., 2016. 211(3): p. 912-25
    [PMID:27125220]