PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca24040.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 343aa    MW: 37736.6 Da    PI: 7.9814
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca24040.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like1023.8e-32163218156
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRla 56 
                 k+r++W+p+LH+rFv+a++ LGGs++AtPk+i+elmkv+gLt+++vkSHLQkYRl+
  Dca24040.1 163 KARRCWSPDLHRRFVNALQMLGGSQVATPKQIRELMKVDGLTNDEVKSHLQKYRLH 218
                 68****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5129413.045160220IPR017930Myb domain
SuperFamilySSF466897.17E-17161221IPR009057Homeodomain-like
Gene3DG3DSA:1.10.10.601.8E-28161221IPR009057Homeodomain-like
TIGRFAMsTIGR015578.2E-27163218IPR006447Myb domain, plants
PfamPF002495.3E-7165216IPR001005SANT/Myb domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0009266Biological Processresponse to temperature stimulus
GO:0009740Biological Processgibberellic acid mediated signaling pathway
GO:0010452Biological Processhistone H3-K36 methylation
GO:0048579Biological Processnegative regulation of long-day photoperiodism, flowering
GO:1903507Biological Processnegative regulation of nucleic acid-templated transcription
GO:0005634Cellular Componentnucleus
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 343 aa     Download sequence    Send to blast
MTSSSELSLE CKTQSYSMLL KSFGDHNQQH DQATQKLEEY LSRLEEERLK IDAFKRELPL  60
CMQLLTNETK QRNGGAFLPF SKTPKNGASL RPLPELGLAS IEGEKKYNES ENGGSISSDN  120
NSSRGGNNNG VSNGNSQAMD NGQATATNTT TTSNNNSNQA HRKARRCWSP DLHRRFVNAL  180
QMLGGSQVAT PKQIRELMKV DGLTNDEVKS HLQKYRLHTR RPSPSPQTTG GQAPQLVVLG  240
GIWVPPEYAN AAAGGPTMYS THPATSQVSS HYCSTMVPQE FYSAPPPLPP PQPQLQHHHQ  300
QQQQLHVYKT TSHTQTHSSP ESNTQEAGNR SESIEDGKSE CSS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
6j4k_A9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j4k_B9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_A9e-14163216154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_B9e-14163216154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_C9e-14163216154Protein PHOSPHATE STARVATION RESPONSE 1
6j4r_D9e-14163216154Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_A9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_C9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_D9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_F9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_H9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
6j5b_J9e-14163216255Protein PHOSPHATE STARVATION RESPONSE 1
Search in ModeBase
Functional Description ? help Back to Top
Source Description
UniProtTranscription factor acting as a flowering repressor, directly repressing FT expression in a dosage-dependent manner in the leaf vasculature. {ECO:0000269|PubMed:25132385}.
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00261DAPTransfer from AT2G03500Download
Motif logo
Regulation -- Description ? help Back to Top
Source Description
UniProtINDUCTION: Up-regulated by SVP. Down-regulated by high temperature and gibberellic acid treatment. Not regulated by photoperiod, circadian rhythm under long days or vernalization. {ECO:0000269|PubMed:25132385}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021741613.11e-108myb family transcription factor EFM-like isoform X1
SwissprotQ9ZQ856e-66EFM_ARATH; Myb family transcription factor EFM
TrEMBLA5BYB11e-111A5BYB1_VITVI; Uncharacterized protein
STRINGXP_010688115.11e-101(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT2G03500.12e-63G2-like family protein
Publications ? help Back to Top
  1. Ding Y, et al.
    Four distinct types of dehydration stress memory genes in Arabidopsis thaliana.
    BMC Plant Biol., 2013. 13: p. 229
    [PMID:24377444]