PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22548.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family G2-like
Protein Properties Length: 710aa    MW: 78250.7 Da    PI: 5.7048
Description G2-like family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22548.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1G2-like76.43.8e-24144197155
     G2-like   1 kprlrWtpeLHerFveaveqLGGsekAtPktilelmkvkgLtlehvkSHLQkYRl 55 
                 kp+l Wt+ LH++F+ea++ + G+ +A+Pk+ile m+v+gLt+e+++SHLQkYR+
  Dca22548.1 144 KPKLIWTTALHNKFLEAISVI-GTSRAVPKKILEYMNVPGLTRENIASHLQKYRI 197
                 79*******************.9*******************************7 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5011011.341143IPR001789Signal transduction response regulator, receiver domain
Gene3DG3DSA:3.40.50.23008.6E-6450No hitNo description
PROSITE profilePS512949.361141200IPR017930Myb domain
Gene3DG3DSA:1.10.10.607.1E-25142202IPR009057Homeodomain-like
SuperFamilySSF466896.54E-18142201IPR009057Homeodomain-like
TIGRFAMsTIGR015577.8E-22144197IPR006447Myb domain, plants
PfamPF002494.0E-6149196IPR001005SANT/Myb domain
Gene3DG3DSA:3.30.40.101.4E-16662707IPR013083Zinc finger, RING/FYVE/PHD-type
PfamPF136394.7E-12662704IPR001841Zinc finger, RING-type
CDDcd001622.31E-12662707No hitNo description
SuperFamilySSF578501.59E-18662709No hitNo description
PROSITE profilePS5008912.74663704IPR001841Zinc finger, RING-type
SMARTSM001841.1E-6663703IPR001841Zinc finger, RING-type
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0000160Biological Processphosphorelay signal transduction system
GO:0003677Molecular FunctionDNA binding
GO:0005515Molecular Functionprotein binding
GO:0008270Molecular Functionzinc ion binding
Sequence ? help Back to Top
Protein Sequence    Length: 710 aa     Download sequence    Send to blast
MHAVMSADDK KNLLMRSLEN GAAFFIVKPP SISDLKNIWQ YVIARRKNNA TIANATIANA  60
IVVKDDVETC NNNNINNNNA MAMFNNNNNN QSDDVFAQAA SYGNNNNNNV LETSSSDNQR  120
QLSMVDKEDN NNEGKSTSSN GSKKPKLIWT TALHNKFLEA ISVIGTSRAV PKKILEYMNV  180
PGLTRENIAS HLQKYRIYVR RLNEANGGLQ HGFPINWNER PFRSSFSWSQ FPTLANNSYL  240
LKYSNTINHQ PQTRAPIPNN YGPHHHQGLP LFNNTPQNTP FVPSSMINNH LGTDFVDDHK  300
LNFNIDITTR STNIIDSSTV DSANNTNASI FDMARHNGLG GSNGDDGPML GLFRHNNADN  360
QFNNNNNSSS NNNNNNKNNS NNSSNNNAFL ERLSNTAPTN NQVDNNMSNM NNSASIGVGQ  420
QGTASNPSNA IVPSSNVDNK VPIGRVGSAN NNANATLQSQ ADEDTKRNEA IPKAIQDELA  480
RLFPDLSHEE ALQHQESLYQ SLKTSNVKQT AATSSQNEAS TSSGSSNERN SSGEPSRSYN  540
NEHDLALDEA LARSLEELDM DDLTTAIYFE KFHSTPPSNS GSSDSTSRVP EITPAPDPAP  600
VPVPVVVVED DINPDEMTYE ELQSLGESIG IESKGMPQSE ISRLPTRIYK TGFFRKKIDL  660
GECPVCFSGY KNNESFTTLP CTHQYHMKCI NEWLAQNKTC PICKEEVVPS
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1irz_A3e-19141203264ARR10-B
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT4G16110.17e-24response regulator 2