PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22439.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family LBD
Protein Properties Length: 188aa    MW: 21036.7 Da    PI: 4.906
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22439.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260135.71.8e-4291081100
      DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaelallke 99 
                 +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++hk+FGasn++kll++lpe +r da+ss+vyeA+ar+rdPvyG++g i +lq+q+++l+aela+ ++
  Dca22439.1   9 PCAACKILRRRCAEKCVLAPYFPPTDPLKFTIAHKVFGASNIIKLLQELPEAQRADAVSSMVYEANARLRDPVYGCAGAICQLQKQVNELQAELAKSRA 107
                 7**********************************************************************************************9987 PP

      DUF260 100 e 100
                 e
  Dca22439.1 108 E 108
                 6 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089126.2288109IPR004883Lateral organ boundaries, LOB
PfamPF031952.1E-429105IPR004883Lateral organ boundaries, LOB
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0005739Cellular Componentmitochondrion
Sequence ? help Back to Top
Protein Sequence    Length: 188 aa     Download sequence    Send to blast
MTPTIIMSPC AACKILRRRC AEKCVLAPYF PPTDPLKFTI AHKVFGASNI IKLLQELPEA  60
QRADAVSSMV YEANARLRDP VYGCAGAICQ LQKQVNELQA ELAKSRAEMV NLQCQQANLL  120
ALICMQDNNN NNNNNNNNNN NYNSNINING SQVTPTSPEN DSFETSTNFL NFYDDNNVNN  180
SMWEPLWT
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
5ly0_A4e-44811610118LOB family transfactor Ramosa2.1
5ly0_B4e-44811610118LOB family transfactor Ramosa2.1
Search in ModeBase
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_021715798.13e-94LOB domain-containing protein 1-like
RefseqXP_021744341.18e-95LOB domain-containing protein 1-like
SwissprotQ9LQR02e-72LBD1_ARATH; LOB domain-containing protein 1
SwissprotQ9SK086e-72LBD11_ARATH; LOB domain-containing protein 11
TrEMBLA0A0K9RV846e-87A0A0K9RV84_SPIOL; Uncharacterized protein
STRINGXP_010669677.12e-90(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.18e-67LOB domain-containing protein 1