PlantTFDB
PlantRegMap/PlantTFDB v5.0
Plant Transcription Factor Database
Previous version: v3.0 v4.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID Dca22326.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; Caryophyllales; Caryophyllaceae; Caryophylleae; Dianthus
Family YABBY
Protein Properties Length: 147aa    MW: 16394.2 Da    PI: 7.6034
Description YABBY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
Dca22326.1genomeDCAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1YABBY28.25.8e-091383169
       YABBY 31 lfkvvtvrCGhCtsllsvnlakasqllaaeshldeslke 69
                +++ vtvrCGhC++llsvn   +s  l+   + +++ ++
  Dca22326.1  1 MYNSVTVRCGHCANLLSVNFGPSSPFLPPDFQ-EHTSED 38
                6899****************999987776554.444444 PP

2YABBY1333.9e-414412192170
       YABBY  92 astsvsseklsenedeevprvppvirPPekrqrvPsaynrfikeeiqrikasnPdishreafsaaaknWahfPkihfgl 170
                 ++ts  s++++++ ++  pr+pp irPPekrqrvPsayn+fikeeiqrika+nP+ishreafsaaaknWahfP+i fgl
  Dca22326.1  44 SNTSGGSSSITTELNDPQPRMPP-IRPPEKRQRVPSAYNKFIKEEIQRIKACNPEISHREAFSAAAKNWAHFPHIQFGL 121
                 34444455677888888999999.9****************************************************97 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PfamPF046901.9E-481121IPR006780YABBY protein
SuperFamilySSF470957.46E-866115IPR009071High mobility group box domain
Gene3DG3DSA:1.10.30.101.8E-469115IPR009071High mobility group box domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0007275Biological Processmulticellular organism development
GO:0010158Biological Processabaxial cell fate specification
Sequence ? help Back to Top
Protein Sequence    Length: 147 aa     Download sequence    Send to blast
MYNSVTVRCG HCANLLSVNF GPSSPFLPPD FQEHTSEDNV SLDSNTSGGS SSITTELNDP  60
QPRMPPIRPP EKRQRVPSAY NKFIKEEIQR IKACNPEISH REAFSAAAKN WAHFPHIQFG  120
LNFDAQRQAR VDQTIAGEGS NRSHGLY
Functional Description ? help Back to Top
Source Description
UniProtInvolved in the abaxial cell fate determination during embryogenesis and organogenesis. {ECO:0000250}.
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_010685467.14e-68PREDICTED: putative axial regulator YABBY 2 isoform X2
SwissprotQ9XFB04e-55YAB2_ARATH; Putative axial regulator YABBY 2
TrEMBLA0A0K9Q8J87e-60A0A0K9Q8J8_SPIOL; Uncharacterized protein (Fragment)
STRINGXP_010685466.12e-65(Beta vulgaris)
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G08465.12e-42YABBY family protein
Publications ? help Back to Top
  1. Sacharowski SP, et al.
    SWP73 Subunits of Arabidopsis SWI/SNF Chromatin Remodeling Complexes Play Distinct Roles in Leaf and Flower Development.
    Plant Cell, 2015. 27(7): p. 1889-906
    [PMID:26106148]